KEGG   Anoxybacillus sp. B2M1: GFC28_3577Help
Entry
GFC28_3577        CDS       T04370                                 

Gene name
apt
Definition
(GenBank) adenine phosphoribosyltransferase
  KO
K00759  adenine phosphoribosyltransferase [EC:2.4.2.7]
Organism
anm  Anoxybacillus sp. B2M1
Pathway
anm00230  Purine metabolism
anm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:anm00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    GFC28_3577 (apt)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:anm04147]
    GFC28_3577 (apt)
Enzymes [BR:anm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.7  adenine phosphoribosyltransferase
     GFC28_3577 (apt)
Exosome [BR:anm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GFC28_3577 (apt)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pribosyltran UPRTase IF3_N
Motif
Other DBs
NCBI-ProteinID: ANB56354
LinkDB All DBs
Position
3590050..3590562
Genome map
AA seq 170 aa AA seqDB search
MDLKQYVTIVPDFPKPGIMFKDITTIMDKGEVYKYATDQIVQYAREKEIDLVVGPEARGF
IIGCPVAYALGVGFAPVRKEGKLPREVVRVEYGLEYGKDVLTMHKDAIKPGQRVLITDDL
LATGGTIEATIKLVEQLGGVVAGIAFLIELTYLEGRNKLDGYDILTLMQF
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atggacttaaaacaatatgtaacgattgtaccggatttcccgaagccagggattatgttt
aaagacattacaaccatcatggataaaggcgaagtgtataaatatgcgacagatcaaatt
gtgcaatatgcgcgggaaaaagaaatcgatcttgtcgttggtccagaagcgcgcggcttt
attatcggctgccctgtcgcttatgcgctcggggttgggtttgcgcctgtaaggaaggaa
ggaaagctgccgcgcgaggtcgttcgtgtcgaatacggtttagagtatggaaaagatgta
ttgaccatgcataaagatgccattaaaccgggacagcgcgtgctgattacagacgatcta
ttagccactggcggaacgattgaagcaacgatcaaactggtagagcagcttggcggtgtg
gtcgccggcattgcattcttaattgagcttacgtatttagaagggcgcaacaaattagat
ggttatgatattttaacattaatgcaattctaa

DBGET integrated database retrieval system