KEGG   Anabaena sp. YBS01: EH233_19125
Entry
EH233_19125       CDS       T06262                                 

Definition
(GenBank) 2-oxo acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ann  Anabaena sp. YBS01
Pathway
ann00010  Glycolysis / Gluconeogenesis
ann00020  Citrate cycle (TCA cycle)
ann00620  Pyruvate metabolism
ann01100  Metabolic pathways
ann01110  Biosynthesis of secondary metabolites
ann01120  Microbial metabolism in diverse environments
ann01200  Carbon metabolism
Module
ann_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ann00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EH233_19125
   00020 Citrate cycle (TCA cycle)
    EH233_19125
   00620 Pyruvate metabolism
    EH233_19125
Enzymes [BR:ann01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     EH233_19125
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H
Other DBs
NCBI-ProteinID: QFZ13953
UniProt: A0A5Q0GIX7
LinkDB
Position
complement(4564725..4566023)
AA seq 432 aa
MSIHEIFMPALSSTMTEGKIVSWVKSPGDKVEKGETVVVVESDKADMDVETFYEGYLAHI
IVEAGDSAPVGAAIAYVAETEAEIEAAKSLGSSGGAAATPSAPPEPVAATAAVGVPAASQ
NGSNHREGRLVASPRARKLAKELKVDLTSLKGSGPYGRIVADDIEAAVGKVKQPATTPTA
PTPTFTPAPVPATRTPAPAPAPAPVAAAPGQVVPFNTLQNAVIRNMVASLDVPVFRVGYT
ITTDGLDKLYKQIKSKGVTMTALLAKAVAVTLQKHPLLNASYSDQGLVYHPDINIAVAVA
MDGGGLITPVLKNADKIDIYSLSRTWKSLVDKARSKQLQPDEYSGGNFTLSNLGMFGVDT
FDAILPPGQGSILAIGASRPQLVATGDGSFAIKQQMQVNITSDHRIIYGADAAAFLQDLA
KLIETDAQSLTL
NT seq 1299 nt   +upstreamnt  +downstreamnt
atgagcattcacgaaatcttcatgccggcgctgagttccaccatgaccgaaggcaaaatt
gtctcctgggtgaaatcgccaggcgataaagtggaaaaaggcgaaacagtggtggttgtc
gagtcagacaaagcagatatggatgtagaaaccttctacgaagggtatctcgctcacatc
attgtagaagctggtgatagcgcacctgtaggagcagcgatcgcttacgtagccgaaacc
gaagcggaaatcgaggccgccaagtctttaggcagttctggtggcgctgcggccactcct
agcgcccctcctgaaccagtcgcagccaccgccgccgtaggtgtaccagccgcatcacaa
aatggctctaaccaccgtgaaggaaggcttgtagcttcaccccgcgcccgcaagttggca
aaagaactgaaagttgatttgaccagtctcaaaggtagtggcccctatggtcgcattgtg
gccgatgacatagaagctgctgttggtaaagtcaagcaaccagccactacaccgactgca
cccacacccacctttaccccagccccagtcccagcaaccaggactccagcaccagcacca
gcaccagcaccagtagcggccgcacctgggcaagtagtaccatttaataccctacaaaac
gctgtcattcgtaacatggtggcgagtctagatgtacccgtgttccgtgtgggttacacc
atcaccaccgatggcttagacaaactttacaaacaaattaaatccaaaggtgtaaccatg
acagcgctactggcgaaagctgtagcggtgacattacaaaaacaccctttattaaatgcc
agctattcagatcaaggtcttgtttaccatcctgacatcaatattgcggtagctgtagcg
atggatggtggcggtttaattacaccagtattaaaaaatgccgacaagatagatatttac
tctctatcacgcacctggaaatctctagtagacaaggccagaagcaaacaactacaacca
gatgaatacagtggtggtaactttaccctatcaaacttggggatgtttggtgtagataca
tttgatgccattttacccccaggacaaggttcaattttagcgatcggcgcatctcgtccc
caattggtagccacaggcgatggttcatttgctatcaaacaacaaatgcaggtaaatatt
acatctgatcaccggattatttacggtgctgatgctgccgcatttttacaagatttagcc
aagttaattgaaactgacgctcaatctttgacactgtaa

DBGET integrated database retrieval system