KEGG   Acinetobacter nosocomialis: RR32_00750Help
Entry
RR32_00750        CDS       T04196                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ano  Acinetobacter nosocomialis
Pathway
ano00473  D-Alanine metabolism
ano00550  Peptidoglycan biosynthesis
ano01100  Metabolic pathways
ano01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ano00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    RR32_00750
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    RR32_00750
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    RR32_00750
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ano01011]
    RR32_00750
Enzymes [BR:ano01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     RR32_00750
Peptidoglycan biosynthesis and degradation proteins [BR:ano01011]
 Precursor biosynthesis
  Amino acid ligase
   RR32_00750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATP-grasp ATP-grasp_3 RimK ATPgrasp_YheCD GARS_A TTL
Motif
Other DBs
NCBI-ProteinID: AJB46725
LinkDB All DBs
Position
161510..162436
Genome map
AA seq 308 aa AA seqDB search
MSNATKFGKVAVLLGGKSAERAVSLDSGQAVLDALLRSGVQAEAFDPQDRSVTELVNYDR
AFIVLHGRGGEDGQIQGVLEWLNIPYTGTGVQGSAIGMDKVKTKQIWQGSDLPTAPYRII
TKETDLDSVIAELGLPVIIKPVHEGSSVGMSKVEKAEDFAAAIEKATQHDAVVMAEKWIT
GREFTISFLNGQPLPVIRLQPPADVAFYDYEAKYQRNDVEYGIPCGLSETEEKKLQALCL
RAFQAVGAEGWGRIDAMQDEQGNFWLLEVNTVPGMTSHSLVPKAAKAVGYSFDELCVAIL
EQTLEGTA
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
gtgtcaaatgctacaaaattcggcaaagttgctgtgttacttggtggaaaatcggctgag
cgtgctgtgtctttagatagtggtcaggcagttctggacgctttgttacgttcaggtgtt
caggctgaggcatttgatccgcaagaccgtagcgtgactgaacttgtaaactatgaccgt
gcatttattgtattgcatggtcgtggtggcgaagacggtcaaatccaaggtgtgcttgag
tggttaaacatcccttatacaggaacgggtgtacaaggttctgcaataggcatggataag
gttaaaaccaagcaaatctggcaaggtagtgacttaccaactgcaccgtatcgcattatt
actaaagaaacagatctagactcagtcattgctgaattaggtttacctgtcattatcaag
cctgtacatgaaggttcaagtgtaggcatgagtaaggttgaaaaagctgaagactttgca
gcagcaattgaaaaggcaactcagcacgatgctgttgtcatggcagaaaaatggattacg
ggacgcgaatttacgatttcattcttaaatggccagccattacctgttattcgtttgcag
ccaccagcagatgtggctttttatgattatgaagcaaaatatcaacgcaatgatgtcgaa
tatggcattccttgcggtcttagcgaaaccgaagagaaaaaactacaagccttatgctta
cgcgcttttcaggctgtaggtgcagaaggttggggtcgtattgatgcaatgcaggatgag
caaggtaatttctggcttctagaagtaaatactgtgccgggtatgaccagccattcactt
gtgccaaaagctgctaaagccgtgggctatagctttgatgaattgtgtgttgcaattctt
gagcaaacattggaaggtacggcttaa

DBGET integrated database retrieval system