KEGG   Acinetobacter nosocomialis: RR32_05230Help
Entry
RR32_05230        CDS       T04196                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
ano  Acinetobacter nosocomialis
Pathway
ano00020  Citrate cycle (TCA cycle)
ano00480  Glutathione metabolism
ano01100  Metabolic pathways
ano01110  Biosynthesis of secondary metabolites
ano01120  Microbial metabolism in diverse environments
ano01130  Biosynthesis of antibiotics
ano01200  Carbon metabolism
ano01210  2-Oxocarboxylic acid metabolism
ano01230  Biosynthesis of amino acids
Module
ano_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ano_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:ano00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RR32_05230
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    RR32_05230
Enzymes [BR:ano01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     RR32_05230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH UBM
Motif
Other DBs
NCBI-ProteinID: AJB47537
LinkDB All DBs
Position
1101479..1103716
Genome map
AA seq 745 aa AA seqDB search
MAGEKSTIIYTLTDEAPLLATYSLLPIIETFTKPAGIEIVKSDISVAARVLAEFADYLSE
EQKVSDNLAELGRLTQDPDTNIIKLPNISASVAQLTACIKELQSKGYPIPDYPENPATEE
EKTIKARYGKCLGSAVNPVLREGNSDRRAPAAVKNYAKKHPHSMSEWKQWSQTHVSHMEE
GDFYHGEKSMTLDRPRNVKMELITNSGKSIVLKPKVALQEGEIIDSMFMSKKALCDFYEK
ELDDCKEAGILFSLHVKATMMKVSHPIVFGHCVKIYYKEAFEKHGKLFDELGINVNNGMA
GLYEKIETLPTSLREEIIEDLHACQEHRPALAMVDSAKGITNFHSPNDIIVDASMPAMIR
AGGKMWGADGKQYDAKAVMPESTFARIYQEMINFCKWHGNFDPKTMGTVPNVGLMAQKAE
EYGSHDKTFEIPEAGIANITDLDTGEVLLTQNVEEGDIWRMCQVKDAPIRDWVKLAVTRA
RNSGMPAIFWLDPYRPHENELIKKVQKYLKDHDTTGLDIQIMSQVRAMRYTLERVVRGLD
TISVTGNILRDYLTDLFPIMELGTSAKMLSIVPLMAGGGMYETGAGGSAPKHVQQLVEEN
HLRWDSLGEFLALAVSLEEMGIKENNARAKLLAKTLDEATGKLLDNDKSPSRRTGELDNR
GSHFYLSLYWAEALAAQDEDAELKAKFAPLAKALAENEQKIVAELAQVQGKAADIGGYYA
VDPAKVSAVMRPSATFNAALSTVQA
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atggctggtgaaaagtcaactatcatttacacactgactgacgaggcgccattattggcg
acttattcgctactgccgatcattgagacctttactaagccagcaggtatcgagattgtt
aaaagtgacatctctgtagctgcacgtgtgctcgcagaattcgctgactacctaagtgaa
gagcaaaaggtatccgacaaccttgctgagctaggtcgtcttacacaagatccagatact
aacattatcaaactcccaaatattagtgcctctgttgcgcaattgacagcatgtattaaa
gaacttcaatctaaaggttatccaattcctgactatccggaaaacccagcgactgaagaa
gaaaaaacaatcaaagctcgttatggcaaatgcctaggttcagcagtaaaccctgtcctt
cgtgaaggtaactcagaccgtcgtgctcctgctgccgttaaaaattacgctaagaaacac
cctcattcaatgagcgagtggaaacaatggtcacaaactcacgtttcacacatggaagaa
ggtgacttctaccacggtgaaaagtcaatgacgcttgaccgcccacgcaacgtaaaaatg
gaacttatcacaaacagtggtaagagcattgttcttaagccaaaagttgcgcttcaagaa
ggcgaaatcattgactcgatgttcatgagcaagaaagcactttgtgatttctatgaaaaa
gaacttgatgattgtaaagaagcaggaattttattctctttacacgttaaagcgacaatg
atgaaagtttcacacccgattgttttcggtcactgtgtgaaaatttactataaagaagct
ttcgaaaaacacggtaaattgtttgacgaattaggtattaacgtaaataacggtatggct
gggttatacgagaaaatcgaaactcttccaacatcattacgtgaagaaatcatcgaagac
ttacatgcttgccaagaacaccgtcctgcacttgcgatggttgactcagcaaaaggtatc
actaacttccattcgcctaacgacattattgtagatgcttctatgcctgcaatgatccgt
gctggtggtaaaatgtggggtgctgatggtaagcaatatgatgctaaagcagtaatgcca
gaatcaacatttgcccgtatttaccaagaaatgatcaatttctgtaaatggcatggtaac
ttcgatccgaagactatgggtacagtgccaaacgttggtttgatggctcaaaaagctgaa
gaatacggttctcacgataagacttttgaaattcctgaagcaggtatcgcaaacattacc
gatcttgacactggtgaagtgttattgactcaaaatgttgaagaaggtgatatctggcgt
atgtgtcaggtgaaagacgctccgattcgtgactgggtaaaacttgcagtgactcgtgca
cgtaactcaggcatgcctgcgatcttctggcttgacccatatcgtccacacgaaaatgaa
ttgatcaagaaagtacagaagtacttaaaagatcacgatacgactggtcttgatatccag
atcatgtctcaagtacgtgcaatgcgttacacacttgagcgcgtagttcgtggcctcgat
acaatttctgtaactggtaacatcttacgcgactacttaactgacttgttcccaattatg
gaacttggaacttctgcgaaaatgttatctatcgttccgcttatggcgggtggtggtatg
tacgagactggtgccggtggttcagcacctaaacacgtacaacaacttgttgaagaaaac
cacttacgttgggattcgcttggtgagttccttgcgcttgcagtttctttagaagaaatg
ggcattaaagaaaataatgctcgtgccaagttacttgcgaaaacacttgatgaagcgact
ggtaaattgctcgacaatgacaagtctccatcacgccgtacaggcgagcttgataaccgt
ggtagccatttctacttatcactttactgggcagaagcacttgcagctcaagacgaagat
gctgagttgaaagctaaatttgctccacttgcaaaagcattagctgaaaacgaacagaag
atcgttgctgagcttgctcaagtacaaggtaaagcagctgacatcggtggttactatgca
gttgatcctgcgaaagtaagcgctgtaatgcgtccaagtgctacatttaatgcagcgctt
tcaactgttcaagcttaa

DBGET integrated database retrieval system