KEGG   Acinetobacter nosocomialis: RR32_05700Help
Entry
RR32_05700        CDS       T04196                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ano  Acinetobacter nosocomialis
Brite
Enzymes [BR:ano01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     RR32_05700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AJB47621
LinkDB All DBs
Position
complement(1212767..1213393)
Genome map
AA seq 208 aa AA seqDB search
MTTITLPALPYGYDDLAPHISKETLEYHHDKHHNTYVVNLNNLIKGTDLEGKTLEEIIKA
TAGDASKAGIFNNAAQVWNHTFYWNSMKPNGGGKPTGAIAAKIDEAFGSYEKFAEEFTAA
ATTQFGSGWAWLVADEVNGKLSITKTSNADTPLAHGQIAVLTIDVWEHAYYIDFRNLRPK
YIATFLENLVNWDYANAKLAGQPAGVEK
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgacaaccattactttacctgcacttccatatggctatgatgatttagcgccacatatc
agtaaagaaactttagaataccatcacgacaaacaccacaacacctatgttgttaactta
aacaacttaatcaaaggcactgaccttgaaggtaaaactttagaagaaatcatcaaagca
actgctggtgacgcatctaaagctggtattttcaacaatgctgctcaagtttggaaccac
actttctactggaacagcatgaagccaaatggtggtggaaagcctactggcgcaatcgct
gctaaaatcgacgaagcttttggtagctacgaaaaatttgcagaagaatttaccgctgct
gcaacaacccaattcggttcaggttgggcttggttagttgctgatgaagtaaacggtaaa
ctttctattactaaaacttcaaatgcagacactccacttgcacatggtcaaattgctgta
ttaacaattgacgtatgggaacatgcttactacatcgatttccgtaacttacgtcctaaa
tacatcgcaactttcttagaaaaccttgtgaactgggactatgcaaatgcaaaacttgca
ggtcagccagctggtgtagagaaataa

DBGET integrated database retrieval system