KEGG   Acinetobacter nosocomialis: RR32_10635Help
Entry
RR32_10635        CDS       T04196                                 

Definition
(GenBank) NADH dehydrogenase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
ano  Acinetobacter nosocomialis
Brite
KEGG Orthology (KO) [BR:ano00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    RR32_10635
Enzymes [BR:ano01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     RR32_10635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_oxidored HI0933_like DAO FAD_binding_3 Thi4 K_oxygenase AlaDh_PNT_C NAD_binding_8 Cytochrom_C_2 FMO-like Spermine_synth Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: AJB48552
LinkDB All DBs
Position
complement(2240435..2242000)
Genome map
AA seq 521 aa AA seqDB search
MLDQNIKTQLKAYLERLESPIELVAALDESDKAAQIKELVTEIAELSDKVTARFDGNNTR
RPSFGVAKAGEQPRVFFAGLPMGHEFTSLILALLQVSGYAPKVSDEVLNQIKGLNLKANF
DVFVSLSCHNCPDVVQALNLIAIYNPNTTATMIDGAFFQDEVEQRKIMAVPMVFQDNEHI
GQGRMTLEEIVAKLDTNSAEKDAAVLNAKDAFDVLVIGGGPAGATAAIYAARKGINTGIV
AERFGGQVMDTMDIENFTSVQKTQGPKFAAEMEAHVREYDVDIMNLQRVSKITGANQTAN
GLVEVELENGAKLESKTVILSTGARWREMNVPGEAEYRTRGVAYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIVEHVTLVEFDTKLRADQVLQNKLNSLPNTTVIMNALSTEVLGD
GSQVTGLKYKDRATDEEHVVELAGIFVQIGLLPNTDFLKESEVELTNRGEIIVNDRNETN
VKGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYIIRSGQ
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgttagatcaaaacattaaaactcaattaaaagcttacctagaacgtttagaaagtcca
atcgaattagttgctgctttggatgaatcagataaagctgcccaaattaaagaattagta
actgaaatcgctgagctttctgacaaggtaacagcccgttttgacggtaacaatacacgt
cgtccaagctttggtgtggctaaagcaggtgaacagcctcgtgtgttctttgcaggctta
ccaatgggccatgagtttacatctttgatcttggcactgttacaagtgtctggctatgca
cctaaagtgtcggatgaggttttaaatcaaattaaaggtttaaacctcaaagccaacttt
gatgtattcgtatcacttagctgtcataactgtccggacgtggtacaggcgcttaacctg
attgcaatttataacccgaacactacggcaaccatgattgatggtgcattcttccaagac
gaagtggaacaacgcaaaatcatggctgtgccaatggtgttccaggacaatgaacacatc
ggtcaaggtcgtatgacgcttgaagagattgtggcaaaacttgataccaactcagctgaa
aaagatgcggcggtactcaatgccaaagatgcctttgatgtattggtgattggtggtgga
cctgcaggtgcaacagcagcaatctatgcagcacgtaaaggtattaacaccggtattgta
gctgaacgcttcggtggtcaggtcatggataccatggacattgaaaacttcacttctgtg
caaaagactcaaggtcctaagtttgctgccgagatggaagcacatgttcgtgaatatgat
gttgatatcatgaacctgcaacgtgtcagcaaaatcacgggtgccaaccaaacagcaaat
ggtctggttgaagttgaacttgaaaacggtgcaaaacttgaatcgaaaactgtgatcctt
tcaacaggagcacgttggagagaaatgaatgtaccgggtgaagctgaataccgtacccgt
ggtgtagcgtactgcccgcactgtgatggtccactgttcaaaggtaaacgtgttgccgtg
attggtggtggtaactcaggtgttgaagcggcaattgaccttgcaggtattgttgagcat
gtaactctggttgagtttgatactaaacttcgtgcagaccaagtgttgcaaaacaagtta
aacagcttgccaaacaccacagtaattatgaatgcgttaagcacagaagtattgggtgac
ggttcacaagtaacaggtcttaaatataaagatcgtgcgactgatgaagagcatgtggtc
gagcttgcagggatctttgtacagattggtttattaccaaacactgacttcttgaaagaa
agtgaagttgagttaactaatcgtggcgagattattgtcaatgaccgcaatgaaaccaat
gtaaaaggtgtattcgctgcaggtgactgtacaactgtaccttacaaacaaatcattatt
gccacaggtgaaggcgctaaagcatcactctctgcatttgattacatcattcgttctggg
caataa

DBGET integrated database retrieval system