KEGG   Acinetobacter nosocomialis: RR32_16235Help
Entry
RR32_16235        CDS       T04196                                 

Definition
(GenBank) heat shock protein Hsp33
  KO
K04083  molecular chaperone Hsp33
Organism
ano  Acinetobacter nosocomialis
Brite
KEGG Orthology (KO) [BR:ano00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:ano03110]
    RR32_16235
Chaperones and folding catalysts [BR:ano03110]
 Heat shock proteins
  HSP33
   RR32_16235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP33
Motif
Other DBs
NCBI-ProteinID: AJB49586
LinkDB All DBs
Position
3453222..3454097
Genome map
AA seq 291 aa AA seqDB search
MSDLRQRFYIEDFPVRGEVVHLEEALQTILAQRDYMPAVKILLGEMLSATALLASTLKIK
GRISLQIQASGSFKWAMAECNHLGEVRALADYETDPRFVEATDSSTVLGALVNPILFINI
EPEHGERYQGIVPLDQTNLAGCLMQYYDLSAQIPTRIVLASTAKRSGGLLIQLLPRHDEE
EQKLVDEDLWPRLTMLTETLKPEELTELSANEILYRLYNEEEVRLPEVEHLKFGCTCSKE
RCAKALIQIGVDAVHETLEAQNPIQMDCQFCNTRYEFTAEEALGLFGEHLS
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatttacgccaacgcttttatatagaggactttcctgttcgcggtgaagtagtt
catctagaagaagcattacaaactattttagctcaacgcgactacatgcctgcggttaaa
attctactaggcgagatgttgagcgcgactgcattacttgcaagtactttaaaaatcaaa
ggccgtatcagcttgcaaatccaggctagcggctcttttaaatgggctatggctgaatgt
aaccatttaggcgaagttcgcgctttagcagactacgaaacagatccacgttttgttgaa
gcaactgacagcagtacagtccttggtgctttagttaatccaattttatttattaacatc
gaacctgagcatggtgagcgttatcaagggatcgtacctcttgaccaaacaaatctagcg
ggttgtttgatgcagtattatgatttatctgctcaaattccaactcgtattgtattggca
agtacagctaaacgttctggtggtttactcattcagttattacctcgtcatgatgaagaa
gagcaaaaactggttgatgaagacctatggccacgtttaaccatgctgactgaaacgctc
aagcctgaagaactaactgagctttcagcgaatgaaattttgtatcgtctttataatgaa
gaagaagtacgcttgccagaagttgaacacttaaaatttggctgtacttgctctaaagag
cgctgtgctaaagcactcattcaaattggtgttgatgctgttcatgaaacactggaagca
caaaacccgattcaaatggattgccagttctgtaatactcgttatgaattcactgccgaa
gaagcattgggtttatttggtgaacacttgagttaa

DBGET integrated database retrieval system