KEGG   Arsenophonus nasoniae: ArsFIN_18990Help
Entry
ArsFIN_18990      CDS       T05992                                 

Gene name
ahpF
Definition
(GenBank) Alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
ans  Arsenophonus nasoniae
Brite
KEGG Orthology (KO) [BR:ans00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    ArsFIN_18990 (ahpF)
Enzymes [BR:ans01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     ArsFIN_18990 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_binding_2 Thioredoxin_3 FAD_oxidored HI0933_like FAD_binding_3 Thi4 NAD_binding_8 AlaDh_PNT_C DAO Glutaredoxin K_oxygenase FMO-like FMN_bind
Motif
Other DBs
NCBI-ProteinID: QBY43332
UniProt: D2U0M1
LinkDB All DBs
Position
1794454..1796016
Genome map
AA seq 520 aa AA seqDB search
MLDNNMRSQLRAYLEKLIQPVELIATLDESEKSAEINALLQDISTLSDKITFITDNNLAV
RKPSFLITNPGKDSGLRFAGLPLGHEFTSLVLALLHVGGHPAKEAAEVLDQIRQLTGQFH
FETYYSLSCHNCPDVIQALNLMAVLNPNITHTAIDGAIFQSEVQQRNIMAVPAVFLNGKE
FGQGRMTLSDIVTKVDVNAEKNTVQKLNQQPPYDVLIVGSGPAGAAAAIYAARKGIRTGI
IGERFGGQVLDTIDIENYISVSRTEGPKLAAALRSHVNDYDIDIIDSQMVAKLIPADTVG
QLHKIETVSGATLRSRSIIIATGAKWRDMNVPGEKEYRTKGVTYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGVVEHVTLLEFAPEMRADAVLQQKLASLNNVDIILQAETLAVKGD
GVKMTGLQYKNRLDGSLNDLAVAGTFVQIGLLPNTQWLDGVITRNAIGEIQVDDKGETNI
KGIFAAGDCTTVPYKQIIIAAGEGAKASLSASQYLMNSMQ
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgcttgataataatatgagatctcaacttagagcctatttagaaaaattaatccagcca
gttgagttaatagcaacattagatgagagtgaaaaatctgccgagataaacgcattatta
caggatatcagcacactgtcagataaaataacttttatcacagacaataacttagcggta
cgtaaaccgtcatttttaattactaatccgggtaaagatagcggattaaggtttgccggt
ttgccgttaggccatgaatttacctcattagttttagcactattgcatgttggcggtcat
cctgcgaaagaagcggcagaagtattagatcaaattcgtcaattaacaggacagtttcac
tttgaaacctattattcattgtcatgtcataattgcccagatgttatccaagctttaaat
ttaatggcggttttaaatcctaatattacgcatactgctatcgatggggctatttttcag
tcagaagtacagcaacgaaatattatggcagtgcctgccgtttttctaaacggtaaagag
tttgggcaagggagaatgactttaagtgacattgtcactaaagttgatgttaatgctgaa
aaaaatactgtccaaaaactgaatcagcagccaccttatgatgtcttgattgtgggtagc
ggtccggccggcgctgcagccgctatttacgcagctcgcaaaggtattcgtaccggtatt
attggcgagcgttttggtggccaagttttagatactattgatattgaaaattatatttct
gtatcgagaaccgaagggcccaaattagcggctgcactacgtagccatgttaatgattat
gatattgatattatcgattcacaaatggtggcaaaacttattcctgccgatactgtgggt
cagttgcataagattgaaaccgtatcgggcgctactttacgttctcgcagtattattatt
gcgacaggagctaagtggcgtgatatgaatgtgccaggcgaaaaagaatatcgtaccaaa
ggggtaacttattgcccccattgtgatgggccgttatttaaaggcaaacgagtcgctgtg
attggtggcggtaattctggcgttgaagccgcgattgatcttgctggcgttgttgagcat
gtgactttattagaatttgccccagaaatgagagcagacgcggtattgcagcagaaacta
gcgagtttaaacaatgtagatattattttacaagctgaaaccctagcagtaaaaggggat
ggtgtaaaaatgactggcttacagtataaaaatcgattggatggttcgctaaatgattta
gcggttgctggaacttttgtccaaattggcttattacctaatacccaatggttagatggc
gtaataacccgtaatgcaatcggtgaaattcaggttgatgacaaaggtgaaaccaatata
aaaggcatttttgctgccggcgattgtacaactgttccctataaacagattattattgcg
gcgggagaaggggcgaaagcatcactcagtgccagtcagtatctaatgaacagcatgcaa
taa

DBGET integrated database retrieval system