KEGG   Arcobacter nitrofigilis: Arnit_0142Help
Entry
Arnit_0142        CDS       T01235                                 

Definition
(GenBank) Succinate dehydrogenase (ubiquinone)
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
ant  Arcobacter nitrofigilis
Pathway
ant00020  Citrate cycle (TCA cycle)
ant00190  Oxidative phosphorylation
ant00650  Butanoate metabolism
ant01100  Metabolic pathways
ant01110  Biosynthesis of secondary metabolites
ant01120  Microbial metabolism in diverse environments
ant01130  Biosynthesis of antibiotics
ant01200  Carbon metabolism
Module
ant_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ant_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ant00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Arnit_0142
   00650 Butanoate metabolism
    Arnit_0142
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Arnit_0142
Enzymes [BR:ant01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Arnit_0142
    1.3.5.4  fumarate reductase (quinol)
     Arnit_0142
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 HI0933_like DAO Pyr_redox_3 FAD_oxidored GIDA Thi4 FAD_binding_3 Rhabdo_glycop BpuJI_N AlaDh_PNT_C Relaxase
Motif
Other DBs
NCBI-ProteinID: ADG91809
UniProt: D5V476
LinkDB All DBs
Position
complement(132760..134349)
Genome map
AA seq 529 aa AA seqDB search
MYDVIIIGSGGAGLSAALSAKEKTNKVLVISKTYPTHSQTVQAQGGINCVLDYENDSISN
HLTDTYKSSKQLGNIKTIKKMCESAQETITWLDRLGVPFSRDTSGNIAQRYFGGTKAKRT
CYSSDYTGLKIIHTLYDNCIKKDIEFLNEHSLIDLIIKNKKYLGINVFNLLNGEEISLYS
KTLIIATGGYGNIYSTHTTNSISTTGDGLAIAFKHGIKLSNLEFIQFHPTALKGTNTLIS
ESARAEGAFLIDDEGKRFVDELTTRDEVARAIKKKIDNGENVYLDMRHININIIKEKMPQ
EKKLIKDIMNLDLHKDLIPIVPAVHYTMGGILTNVSCETSIKDIFACGEVAQNNTHGANR
LGGNSLLEIITFGKIAGSNAAEISLKKEIAIPKNIASNTINSILKKKIGKSIYKIKNELS
EAMFAYAGLYRTENDLDKLNLLIEKFEKEYKDSGIENKSKRYNKNIIDYIELGNLLLLSK
LVCQSALKRKESRGSHFRKDYEQINKEYQKISTFQNIKGKSEFKLEEPL
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgtatgatgtaataattattggttctggtggtgctggattaagtgcagcattaagtgct
aaagaaaaaacaaataaagtacttgttatatcaaaaacctaccctactcattctcaaaca
gtgcaagcacaaggtggaataaattgtgttttagattatgaaaatgattcaatttctaac
cacctgactgatacttacaaatcatcaaaacaattaggcaatattaaaaccataaaaaag
atgtgtgaaagtgctcaagaaactataacttggttagatagattaggagtaccattttca
agagatacaagtgggaacatagcacaaagatattttggtggaacaaaggcaaaaagaact
tgctattcttctgattacactggtcttaaaattattcatactttatatgataattgtatt
aaaaaggatattgagtttttaaatgaacactctcttattgatctaattataaaaaataaa
aagtacctaggtataaatgtttttaacctattaaatggtgaagaaattagtttatactcc
aagactctcataattgcaacaggaggctatgggaatatatattcgactcatacaacaaat
agtatttcaactacaggtgatgggcttgcaatagcttttaaacatggaattaagctatca
aatctagaattcatacaatttcaccctactgcactaaaaggcactaatactttaattagt
gaaagtgctagagcagaaggtgcttttttgattgatgatgaaggcaaaagatttgttgat
gaattaacaacaagggatgaagtcgcaagagcaattaagaaaaaaattgataatggtgaa
aatgtttatttagatatgcgccatataaatattaatataataaaagagaaaatgccccaa
gagaaaaaactaataaaagatattatgaatctagatcttcataaagatttgattcctatt
gttcctgctgtacactatacaatgggtggtattttaaccaatgtttcatgtgaaacatca
ataaaagatatctttgcctgtggagaagtagcacaaaataatacacacggtgcaaatagg
ttaggaggaaactcactattagaaattataacttttggtaaaatagctggaagtaatgct
gctgaaatatccttgaaaaaagagatagcaattcctaagaacatagcatccaatacaata
aattcaatactaaaaaaaaagattggaaaatctatttataaaataaaaaatgagctaagt
gaagcaatgtttgcttatgcaggattatatagaacagaaaatgatttagataaacttaat
cttttgattgaaaagtttgaaaaagaatacaaagacagtggaatagaaaataaaagcaag
agatacaacaaaaatattattgattatattgaattaggtaatttattacttttatcaaaa
cttgtatgtcaatctgctctaaaaagaaaagagtctagaggttcacattttagaaaagac
tatgaacaaatcaataaagaatatcaaaagatatcaacctttcaaaatattaaaggtaag
tctgaatttaagcttgaggaaccactatga

DBGET integrated database retrieval system