KEGG   Arcobacter nitrofigilis: Arnit_0285Help
Entry
Arnit_0285        CDS       T01235                                 

Definition
(GenBank) pyruvate flavodoxin/ferredoxin oxidoreductase domain protein
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
ant  Arcobacter nitrofigilis
Pathway
ant00010  Glycolysis / Gluconeogenesis
ant00020  Citrate cycle (TCA cycle)
ant00620  Pyruvate metabolism
ant00633  Nitrotoluene degradation
ant00640  Propanoate metabolism
ant00650  Butanoate metabolism
ant00680  Methane metabolism
ant01100  Metabolic pathways
ant01110  Biosynthesis of secondary metabolites
ant01120  Microbial metabolism in diverse environments
ant01130  Biosynthesis of antibiotics
ant01200  Carbon metabolism
Module
ant_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ant00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Arnit_0285
   00020 Citrate cycle (TCA cycle)
    Arnit_0285
   00620 Pyruvate metabolism
    Arnit_0285
   00640 Propanoate metabolism
    Arnit_0285
   00650 Butanoate metabolism
    Arnit_0285
  09102 Energy metabolism
   00680 Methane metabolism
    Arnit_0285
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Arnit_0285
Enzymes [BR:ant01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Arnit_0285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C
Motif
Other DBs
NCBI-ProteinID: ADG91951
UniProt: D5V4Y9
LinkDB All DBs
Position
complement(272932..274161)
Genome map
AA seq 409 aa AA seqDB search
MNSKQMELNKVEVWDGNTCNAQAFRQAAVDVLAAYPITPSTNTVETYASFHANGYVDGEI
IMVESEHAAMSGCVGAGAAGGRVATATSSQGCALMVEVLYQCSGMRIPVVLCLVNRALAA
PLNVNGDHSDMYLTRDAGWIQLDSFNAQEAYDLTLCSFKIGEHKDVRLPVISNQDGFLTS
HTAQTVRPLSDKVAYDFVGDYLQVNAMLDFTNPVTHGVQTEHDWHFEHKAKQHAALMGSL
FVVEEVFEEFEKISGRKYNLVESYKVEDADVVIVCLGTTYETAMIAVDAIREETGIKAGV
LAPRLFRPFPLTQLASKLQNVKAIACMDRSAPGGTVGTLYNEVAGALFNTQARPILKNLV
YGLGGRDIIVNELKEIFVSLNEEAKNGKLNGKIQTLHGVRGPELSFYEH
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgaatagcaaacaaatggaactaaataaagtagaagtttgggatgggaatacctgtaat
gctcaagcatttagacaagcagctgttgatgtacttgctgcttatcctataacaccttca
acaaatacagttgaaacttatgcttcttttcatgcaaatggatatgtggatggtgaaatc
attatggtggaatctgagcatgctgcaatgtctggttgtgttggtgcaggagctgctggt
ggaagagtagcaactgctacttcatcacaaggttgtgctttgatggtagaagttttatat
caatgttctggtatgagaatccctgttgttttatgtttagtaaatagagcattagcagca
cctttaaatgtaaatggtgaccattcagatatgtaccttacaagagatgcaggctggatt
caactagactcatttaatgcacaggaagcttatgatttaacactatgttcttttaaaatc
ggtgagcacaaagatgtaagacttccagttatctctaatcaagatggatttttgacttct
catacagcccaaacagtaagaccactgtctgataaagtggcttatgattttgtaggtgac
tatttgcaagttaatgcaatgttggattttacaaaccctgttactcatggagttcaaaca
gagcatgactggcactttgaacataaagctaaacaacatgcagccctaatgggttcactt
tttgttgtggaagaagtttttgaagagtttgaaaaaattagtggaagaaaatataatctt
gtagaatcatataaagtagaagatgcagatgttgtaattgtatgtttaggaactacttat
gaaacagcaatgatagcagttgatgccataagagaagaaacaggaataaaagctggtgtt
ttagcaccaagactttttagaccatttcctcttacacaattggcttcaaaattacaaaat
gtaaaagctatagcatgtatggatagaagtgcacctggtggaacggttggaactttatac
aatgaagttgcgggagccttatttaatacccaagctagaccaattctgaaaaacttagta
tatggtttaggtggaagagatattattgtaaatgaattaaaagagatttttgtctcttta
aatgaagaagcaaaaaatggaaaacttaatgggaaaattcaaacacttcatggtgtaaga
ggtcctgagttaagtttttatgaacactaa

DBGET integrated database retrieval system