KEGG   Arcobacter nitrofigilis: Arnit_1083Help
Entry
Arnit_1083        CDS       T01235                                 

Definition
(GenBank) D-alanine/D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ant  Arcobacter nitrofigilis
Pathway
ant00473  D-Alanine metabolism
ant00550  Peptidoglycan biosynthesis
ant01100  Metabolic pathways
ant01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ant00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Arnit_1083
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Arnit_1083
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    Arnit_1083
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ant01011]
    Arnit_1083
Enzymes [BR:ant01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Arnit_1083
Peptidoglycan biosynthesis and degradation proteins [BR:ant01011]
 Precursor biosynthesis
  Amino acid ligase
   Arnit_1083
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_4 CPSase_L_D2 RimK DUF3962 ATP-grasp_3 ATPgrasp_TupA GARS_A
Motif
Other DBs
NCBI-ProteinID: ADG92745
UniProt: D5V3R7
LinkDB All DBs
Position
1067673..1068707
Genome map
AA seq 344 aa AA seqDB search
MKIAIVFGGSSYEHEISIVSAIAMKDVIKSELEYIFLDENREFYHIPTKTIKSKLFSTGE
YKKCDKLNIKKGGFSKKAMFGEKNVEFDIVLNLIHGGDGEDGTVASLFEFFDIKYIGPRV
GACSVSFNKFLTKGYASSLGIKTIPYKYFTKFDEISVDEFPVIVKPVTLGSSIGVSIVKT
KEELSYALDVAFEFDNAVLIETFVPNIKEYNLAGYKIGNEIKYSIIEEPQKADFLDFDKK
YLDFARTERVSVANISDELKEKLKKAFATIYNTTFNDAMIRCDFFVIDDEVYLNEINPIP
GSMANYLFEDFDASIKELSKSLRLKDKIKISYDYVNKIQAAKGK
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaagattgctatagtttttggtggaagtagttatgaacatgagatttcaatagtatct
gctattgcgatgaaagatgtgataaaaagtgaattagagtatatatttttagatgagaac
agagaattttatcatattcctactaaaacaataaagtcaaaactttttagtactggtgag
tataaaaagtgtgataaattaaatatcaaaaaaggtggcttttcaaaaaaagctatgttt
ggagaaaaaaatgttgagtttgatattgtcttaaatttaatccatggtggtgatggtgaa
gatgggacagttgcctctctttttgaattttttgatataaaatatataggtccaagagtt
ggagcttgtagtgtaagtttcaataagtttttgacaaaagggtatgcttcatctttaggt
attaagacgataccttataaatactttacaaaatttgatgaaataagtgtagatgaattt
ccagtaattgtaaaaccagttactttaggaagttcgattggggttagtattgtaaaaaca
aaagaagagttaagttatgcacttgatgttgcttttgagtttgataatgcagttttaata
gagacttttgtgccaaatataaaagagtacaatcttgcaggttataaaataggaaatgaa
atcaaatattcaataatagaagagccacaaaaagctgactttttagattttgataaaaag
tatcttgattttgcaagaactgagagagtaagtgttgctaatattagtgatgagttaaaa
gagaagttaaaaaaagcttttgcaactatttataatacaacttttaatgatgcgatgatt
agatgtgatttttttgtaatagatgatgaagtatatttaaatgagattaacccaatccct
ggttctatggcaaactatctgtttgaagattttgatgcaagtataaaagagctatcaaaa
tcattaagactaaaagataaaatcaaaatctcatatgattatgtaaacaaaatccaagcg
gctaagggtaaataa

DBGET integrated database retrieval system