KEGG   Aneurinibacillus sp. XH2: ACH33_03385Help
Entry
ACH33_03385       CDS       T04247                                 

Definition
(GenBank) hypothetical protein
Organism
anx  Aneurinibacillus sp. XH2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF86
Motif
Other DBs
NCBI-ProteinID: AMA71976
UniProt: A0A109QC46
LinkDB All DBs
Position
696644..697072
Genome map
AA seq 142 aa AA seqDB search
MYQVNVEKIEEHLSYLERVLEKVIPVLKHEESAAEDMLTNLALERALHVALETIADVGNY
LIDGFIMRDPGSYEDIVDILEDEKVIDSEMAAALKSVVNMRKKLITHYTTVDRQEVYTLL
RTHSPQLQQFPARVRDYLAREL
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgtaccaggttaacgtggaaaaaatcgaggagcatttatcctatttggaacgggttctt
gaaaaagttatacctgtgctcaagcatgaggaaagcgccgctgaggacatgctgaccaac
ctagcgttggaacgtgcgcttcatgttgccttggagacgatagctgacgtaggaaactat
ttgatcgatggttttatcatgcgtgatcccggtagctatgaagacattgttgacattctt
gaagatgaaaaggtgattgacagtgagatggcggctgcgttgaaatcggtggttaatatg
cgcaagaagttgattactcactatacgacagtggatcgtcaagaggtgtacacccttttg
cgtacccattccccccagcttcagcaatttccggcgcgtgtacgcgattacttggcacgt
gaattgtaa

DBGET integrated database retrieval system