KEGG   Aneurinibacillus sp. XH2: ACH33_12825Help
Entry
ACH33_12825       CDS       T04247                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K22187  alpha-ketoglutaric semialdehyde dehydrogenase [EC:1.2.1.-]
Organism
anx  Aneurinibacillus sp. XH2
Pathway
anx00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:anx00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ACH33_12825
Enzymes [BR:anx01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     ACH33_12825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AMA73652
UniProt: A0A0X8D494
LinkDB All DBs
Position
complement(2597766..2599211)
Genome map
AA seq 481 aa AA seqDB search
MRYLNYINGEWKKPVSGEYIENRNPHNWEEVLGEFPMSAAEDVYEAVQAAKKAFAVWKKL
SFQQRASYLLKAAEYLKANLEEVGRDLTLEEGKTLVEGIGETQRAISILEYYAAEGRQPV
GEVVPSANAETFLYTTRVPVGPIGLITPWNFPIAIPVWKMAPALIYGNTVVIKPAEITPK
SVYHVMKAFEAAGLPAGVVNCVFGSGSVVGSEIVEHPDIKAVSFTGSNTVGLRIQERATA
KGKKVQLEMGGKNPLIVLADADLNKAVNIAISGAFRSTGQKCTATSRVIVEEGIYDAFRD
LLVERTKALKVGNPLEKDTFMGPAVSKTQRDGIMAMIEAGKQEATLLCGGEAPADPELAN
GFYVLPTIFENVSRDARIAREEIFGPVIALFKVKNYEEAVGLANDTEYGLSSAICTNNLT
LAQRFVDDIEAGIVHVNSETAGAEPQVPFGGCKNSSTGSREQGKAAIEFYTQVKTVYMDR
M
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgcgttatttaaactatatcaacggtgaatggaaaaaacctgtgagcggcgaatatatc
gaaaatcgtaacccgcacaactgggaagaagtgctaggcgagtttccgatgagcgcagcg
gaagatgtgtatgaagcggtccaagcagcgaaaaaagcgtttgcggtatggaaaaagctt
tcttttcagcagcgtgcatcctacttgctaaaggcggctgaatatttaaaggcaaatttg
gaagaagtaggccgcgatctaacgctagaagaagggaaaacgctggtggagggaatcgga
gaaacacagcgggccatcagcattctcgaatactatgcggcggaaggacggcagccggtc
ggtgaagtggttccttcggcgaacgcggaaacgtttctttatacgacccgtgtgccagtg
gggccgatcggtctgattacgccgtggaacttcccgattgccattcctgtgtggaaaatg
gctccggcgcttatctatggcaataccgtggtcattaaacctgccgaaattacgccgaaa
tctgtgtaccatgtaatgaaagcgtttgaagcagcgggccttcctgcgggtgttgttaac
tgcgtgtttggcagcggttcggttgtcgggtcagagatcgttgaacatccggatattaaa
gcagtgtctttcaccggctcaaatacggttggcctgcgcattcaagagcgcgcaactgca
aaaggaaaaaaagtgcagctggagatgggcggtaaaaacccgcttatcgtgctggctgac
gccgatctgaacaaagcggtgaatatcgctattagcggcgcgttccgttccacaggacaa
aagtgtacggccacaagccgtgtgattgtggaagaaggaatttatgatgcgtttcgtgac
ttgcttgttgagcgtacgaaagcgctcaaagtgggcaatcctctggaaaaagacacgttt
atgggcccggctgtttctaaaacacagcgcgatggtattatggcgatgattgaggcagga
aaacaagaagcgacgctgctttgcggcggtgaggcgccggccgatccggaacttgcgaac
ggcttctatgtgctgccgacgatttttgaaaacgtaagccgcgacgcccgtatcgcgcgc
gaggaaatttttgggccggttatcgcgctttttaaagtaaagaactacgaagaagcagtt
ggactggcgaacgatacagaatatggcctcagctccgcgatttgcacgaataaccttacc
ttggcgcaacggttcgtggatgatattgaagcgggcattgtgcacgtgaattcagaaaca
gcgggagcggagccgcaagtgccgtttggcggctgcaaaaactccagcactggatcccgt
gaacaagggaaagcagcgattgaattttatacccaagtgaaaacggtatacatggatcgg
atgtga

DBGET integrated database retrieval system