KEGG   Aneurinibacillus sp. XH2: ACH33_15460Help
Entry
ACH33_15460       CDS       T04247                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
anx  Aneurinibacillus sp. XH2
Brite
Enzymes [BR:anx01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     ACH33_15460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AMA74077
UniProt: A0A109QJ62
LinkDB All DBs
Position
3096108..3096719
Genome map
AA seq 203 aa AA seqDB search
MAKFELPALPYPFDALEPHIDAQTMEIHHDRHHATYVNNLNAALEGHTELANKSIEDLMR
NIGNVPESIRTAVRNNGGGHYNHSLFWAIMSPNGGGEPTGELANAINEAFGSFEKMKEEF
AKAAAGRFGSGWAWLIVDNGKLAITSTPNQDNPLMEGKTPILGLDVWEHAYYLKYQNKRP
DYISAWWNVVNWDEVSKRYNDAK
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaatttgaattaccagctctaccttacccatttgatgcacttgaacctcatatt
gacgcgcaaacgatggaaattcaccacgatagacaccatgcaacatacgtgaacaatctg
aatgcagcactcgaaggacatacagaattagcaaacaaaagcattgaagatttaatgcgc
aacattggcaacgtaccagaaagcatccgcacagccgttcgcaacaatggcggcggtcac
tataaccatagcctgttctgggcaatcatgagcccgaacggtggcggcgaaccgactggt
gaactggctaacgctatcaacgaggctttcggaagcttcgaaaaaatgaaagaagaattc
gcaaaagcggcggctggccgtttcggaagcggttgggcttggttaattgtagacaacggg
aaactagctatcacgagcacaccaaaccaagacaatccgctgatggaaggcaaaactcca
atccttggcttggatgtatgggaacacgcttactatctgaagtaccaaaacaagcgtccg
gattacatttccgcttggtggaacgttgtaaactgggacgaagtaagcaaacgctacaac
gacgcgaaataa

DBGET integrated database retrieval system