KEGG   Aneurinibacillus sp. XH2: ACH33_16435Help
Entry
ACH33_16435       CDS       T04247                                 

Definition
(GenBank) hypothetical protein
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
anx  Aneurinibacillus sp. XH2
Pathway
anx01100  Metabolic pathways
anx01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:anx00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    ACH33_16435
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    ACH33_16435
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:anx01011]
    ACH33_16435
Enzymes [BR:anx01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     ACH33_16435
Peptidoglycan biosynthesis and degradation proteins [BR:anx01011]
 Precursor biosynthesis
  Racemase
   ACH33_16435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Orn_Arg_deC_N
Motif
Other DBs
NCBI-ProteinID: AMA74253
UniProt: A0A0X8D6H1
LinkDB All DBs
Position
complement(3322551..3323735)
Genome map
AA seq 394 aa AA seqDB search
MEAFYRDVWAEIDLDAIGRNIKTFRKHIPSETKIMAVVKADGYGHGAFQIARRALKEGAD
WLGVALLDEALELRHQGIEAPILVLSSFPTRGIRLAIEHDITMTVYQLEMLRKISQEAEK
QKKRTKIHIKVDTGMGRIGMRSEEELGAFMETVRDCPWVEVEGMFTHFATADEEDGTYTK
EQFQMFQRFVDSLEERGMKVPLLYTNNSAAAMFYPEQSRHMIRLGISLYGQYPSRYSKTT
GIPLAPAFQWKARISHVKQVPAGAKIGYGATYEAKRDAVIATVPAGYADGYNRLLSNKGY
VLVKGYRAPIAGRVCMDQFMIDVTHIPNVAAGEEVVLIGRQGNEEISVDEMAEWLTTINY
EVTCMVSKRVPRVYYENGRIVAVNNHILPDFCKE
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggaagcattctatcgggatgtctgggctgaaatcgacctagacgccattggaagaaat
attaaaacatttcgtaagcacattccttcagaaacaaaaattatggcggttgttaaggcg
gatggttatggtcatggtgcttttcaaatagcgaggcgggcgcttaaggaaggcgctgat
tggctgggggtcgcgttgttggatgaagcgttggaacttcgtcaccaaggaattgaagcg
ccaattcttgttctcagttcatttcctacccggggaatcaggctggccatcgaacatgac
atcactatgacagtatatcaattggagatgttgcggaaaatttctcaggaagctgaaaag
caaaaaaagcggacaaaaattcacataaaagtggatacaggcatgggacgtatcggtatg
cggagcgaggaagaattaggagcattcatggaaacggtgcgcgattgtccgtgggtagag
gtcgaagggatgtttactcactttgcaacagctgatgaggaggacggcacctacacaaaa
gagcagtttcagatgttccaacgctttgtggatagtctggaggaaagaggaatgaaggtt
ccactcctgtatacaaataacagcgcagcggccatgttctacccggagcaaagccgtcat
atgatccgtttgggtattagtttgtatggccagtatccttctaggtactcgaaaacgaca
ggtatcccgctagcgcctgcgtttcaatggaaggcgcggattagtcatgttaaacaagtg
ccggccggggcaaaaatcggctatggtgcgacttatgaagcgaaacgagatgcggttatt
gccaccgttccggcagggtatgcggatggatacaatcgtttgctgtcgaataaggggtat
gtgcttgttaaaggttatcgagcgccgatcgctggacgtgtctgcatggatcagttcatg
attgatgttacgcacattccgaatgtagctgcgggagaggaagtagttttgatcgggcga
cagggcaacgaagagatttcggtagatgagatggcggaatggctgacgacgattaactat
gaggttacatgcatggttagcaaacgggttccacgcgtatattacgaaaatggccgcatt
gttgctgtaaacaatcacatattaccagacttctgtaaggagtag

DBGET integrated database retrieval system