KEGG   Azoarcus olearius: dqs_0802Help
Entry
dqs_0802          CDS       T04423                                 

Definition
(GenBank) nucleoside hydrolase
  KO
K03574  8-oxo-dGTP diphosphatase [EC:3.6.1.55]
Organism
aoa  Azoarcus olearius
Brite
KEGG Orthology (KO) [BR:aoa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:aoa03400]
    dqs_0802
Enzymes [BR:aoa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.55  8-oxo-dGTP diphosphatase
     dqs_0802
DNA repair and recombination proteins [BR:aoa03400]
 Eukaryotic Type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    dqs_0802
 Prokaryotic Type
    dqs_0802
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TMP-TENI NUDIX NUDIX_4 Thrombin_light NUDIX_2
Motif
Other DBs
NCBI-ProteinID: ANQ83872
LinkDB All DBs
Position
828836..829783
Genome map
AA seq 315 aa AA seqDB search
MGARKIVNVAAGVILERGRVLLGQRAPDTFYPGYWEFPGGKVEPGESAADALKRELAEEL
GIVVPHVRPWLTREHDYEHAHVRLHFFEVPAWSGAPVAHVHAALRWAEPELIATACAPML
PANGPILKALQLPRRMGITQAAERGVARQLDELEQALGAGLRLVQVREAALPRRQQIEFA
QEVVRRVAAAGGIVVINGDLDLARAVGAPGVHLPSAALLDCTVRPAFEWVGASCHSEEEL
LAAAALGLDYAVLGPVRPTASHPGQAALGWARFGELAGTLPFPVFALGGLGWGDMDCARD
HGAHGVAAIRGAWGA
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
gtgggcgcccgcaagatcgtcaatgtcgcggccggggtcatcctggagcgcggacgggtg
ttgctcgggcagcgcgcacccgacaccttctatcccggctactgggaattccccggaggc
aaggtcgaacctggcgaatccgcggcagatgcgctcaagcgcgagctggccgaggagcta
ggcatcgtggtgccgcacgtgcggccctggctgacccgcgagcacgactacgaacacgct
cacgtccgcttgcacttcttcgaggttccggcgtggtccggagcgccggtggcgcacgtg
catgcggcgctgcgctgggccgagccggagctgatcgcgaccgcgtgcgcgccgatgttg
cccgccaacggcccgatcctgaaggcgctgcaactgccgcgccggatgggtatcacgcag
gccgccgaacggggcgtggcgcgtcagctggacgagcttgagcaggccctgggcgcgggc
ctgcgcctggtgcaggtgcgcgaagcggcgctgcctcgccggcagcagatcgaattcgca
caggaagtggtgcgccgcgtagccgcggccggtggaatcgtggtcatcaatggcgacctc
gatcttgcccgtgcagtgggtgcgcccggggtgcaccttccgtcagcggcactccttgat
tgcacggtccgccccgcgttcgagtgggtcggagcgtcttgccactcggaagaggagctg
ctggcggcggcggccctggggctggactacgccgtgctcgggccggtgcggcccacggca
tcccatcctggccaggctgcgctcggctgggcgcgctttggcgagttggcaggcacgctg
ccatttccggtctttgcgctcggtggtctcggctggggcgacatggattgcgcccgcgac
catggggcgcatggtgttgcggcgatccgcggggcgtggggcgcttag

DBGET integrated database retrieval system