KEGG   Azoarcus olearius: dqs_0845Help
Entry
dqs_0845          CDS       T04423                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
aoa  Azoarcus olearius
Brite
KEGG Orthology (KO) [BR:aoa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    dqs_0845
Enzymes [BR:aoa01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     dqs_0845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 DAO HI0933_like FAD_oxidored AlaDh_PNT_C FAD_binding_3 Glutaredoxin K_oxygenase FMO-like Thi4 NAD_binding_8 NAD_binding_9
Motif
Other DBs
NCBI-ProteinID: ANQ83914
LinkDB All DBs
Position
870402..871955
Genome map
AA seq 517 aa AA seqDB search
MLDANIKTQLKAYLERVTQPIEIVASLDDGAKSREMQELLADVAEQSHLITVIERRDDNE
RKPSFSVGPKGGEARVRFAGLPMGHEFTSLILALLQSAGYPPKVEADVIEQIKALEGEFN
FETYISLSCHNCPDVVQALNLLSILNPNIRHTMIDGGVFQEEVEKRQIMAVPTVYLNGQE
FGAGRMELGEILAKIDTGAAKRDAAKLSAKDVFDVLVVGGGPAGAAAAIYAARKGIRTGV
LAERFGGQVMDTLAIENFISVKETEGPKLAMALEEHVKQYEVDVMNLQRATALVPGDIHE
VRLENGGTLKAKTVILATGARWREMNVPGEKEYRGKGVAYCPHCDGPLFKGKRVAVIGGG
NSGVEAAIDLAGIVAHVTLLEFADTLRADAVLQKKLASLPNVTVIKSAQTTEVTGAEKVN
GLVYKDRVSGEEKRLELEGIFVQIGLLPNTDFLKGTVELTRFGEIIVDAKGQTSVPGVFA
AGDCTTVPYKQIIIAMGEGSKASLAAFDHLIRTSVPA
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgctggacgccaacatcaagactcaactgaaagcctatctggagcgggtgacgcagccg
atcgagatcgtggcgtcgctggacgatggcgcgaagtcgcgcgaaatgcaggaactgctg
gccgacgtcgccgagcagtcccacctgatcaccgtgatcgagcggcgcgacgacaatgag
cgcaagccctcgttctcggtcggccccaagggcggagaggcgcgcgtgcgctttgccggc
ctgccgatgggccacgaattcacctcgctcatcctcgcgctgctgcagtcggcgggttat
ccgccgaaggtcgaagccgacgtgatcgagcagatcaaggcgctcgaaggcgagttcaac
ttcgagacctacatctcgctgtcctgccacaactgcccggacgtggtgcaggccttgaac
ctgctgtccatcctcaaccccaacatccgccacaccatgatcgacggcggcgtgttccag
gaagaggtcgagaagcgccagatcatggcggtgcccaccgtctatctcaacggccaggag
tttggcgccggccgcatggaactcggtgaaatcctcgccaagatcgacaccggtgcggcc
aagcgcgacgcggccaagctctccgccaaggacgtgttcgacgtgctcgtcgtcggcggc
ggtccggcgggcgccgcggcggcgatctacgcggcgcgcaagggcatccgcaccggcgtg
ctggccgaacgcttcggcggccaggtgatggacacgctcgcgatcgagaacttcatctcg
gtgaaggaaaccgaaggtccgaagctcgcgatggcgctggaggagcacgtcaagcagtac
gaggtcgacgtgatgaacctgcagcgggcgaccgcactggtgccgggcgacatccacgag
gtcaggcttgaaaacggtggcacgctgaaggcgaagacggtgattctggcgaccggggcg
cgctggcgcgaaatgaacgtgccgggcgaaaaggaataccgcggcaagggcgtggcttac
tgcccgcactgcgacggcccgctgttcaagggcaagcgcgtggcggtgatcggcggcggc
aactccggcgttgaagccgcgatcgatctcgccggcatcgtcgcccatgtcacgctgctg
gaatttgccgacaccctgcgtgcggacgcggtgctgcagaagaagctcgccagcctgccc
aacgtcacggtgatcaagagcgcacagaccaccgaggtgaccggggccgaaaaggtgaat
ggcctggtgtacaaggaccgcgtgagcggcgaagaaaagcgcctggagctggaaggcatc
ttcgtgcagatcggtctgctgcccaacaccgacttcctgaagggcacggtcgaactcacc
cgcttcggggagatcatcgtcgatgccaagggtcagacctcggtgccgggcgtattcgcc
gcgggcgactgcaccacggtgccgtacaagcagatcatcatcgcgatgggtgagggatca
aaggcctcgctggcggccttcgatcacctgatccggacgtcggtgcctgcctga

DBGET integrated database retrieval system