KEGG   Azoarcus olearius: dqs_1371Help
Entry
dqs_1371          CDS       T04423                                 

Definition
(GenBank) putative serine/threonine protein kinase
Organism
aoa  Azoarcus olearius
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase HDOD Pkinase_Tyr APH Kdo Kinase-like GAF GAF_3 RIO1 KIX_2
Motif
Other DBs
NCBI-ProteinID: ANQ84424
LinkDB All DBs
Position
1436279..1438651
Genome map
AA seq 790 aa AA seqDB search
MADRVGRFEIRGELGRGAQSVVYRAFDPQLEREVAVKTLHFTEHKPGQNETLLAEARIVS
PLRHPGIVPIFEAGEADGDVYLVFEYVRGESLAAHMQREGALAPVRAGEILVQILAAVGQ
AHAEGIIHRDLKPTNVLMDESGAVRVMDFGIACRTAGKGGQAGFAGTPSYMAPEYITTRE
VSERIDVFAAGVIFIELLTGRRLFAGDDVDQVMQRIVARQVVLPTDLALDERVAGIALRA
VARDPAERFESAAAFRQALEAWLQPDEAVQSAEARQSTVDFLLRRMRHKSDFPALSESVS
AINRIASSESESVSKLSVSILRDFSLTNKILRLVNSVAYRQAGGGSISTVSRAVIVLGFD
TVRNIAITVLLFEHLQNKANASQLKEDFLRANLAGILARDIASKARTRDLEQSFICAIFH
NLGRLLTQFYFPEESEEIRRMMAQKSCTEEVAALRVLGLSFEDLGIGIARSWGFPTLIVD
SMHKLPAGKVRKPATQEDRLRVVSALSNEISTAIATLSPEERAKEMQRIAARFAEAQPLD
DTELKDAIKHAIEEITEFARIIRINLGQTHFGQQLRRYSGGETGGEGGGSDGSMGSAVLE
QNRSPALETGNFGEEGRKAADAQAVLTAGIQDISNTLVEEFKLNDILRIILETMYRAMGF
RRVLLCIRDARSNTMQGRFGFGPEVTELAKQFRFTLSFTPDIFHAATSKGVDILISDVDD
AKIAERIPAWFRKGVTAKTFVLFPLTIKNAPVALIYADKEHAGEIEITEKELSLLRTLRN
QAVLAIKQST
NT seq 2373 nt NT seq  +upstreamnt  +downstreamnt
atggctgacagggtaggacgcttcgaaatcaggggggagctgggccgcggtgcgcaaagc
gtggtgtatcgggctttcgatccgcagctggagcgcgaggttgcggtcaagacgctgcac
ttcaccgagcacaagccggggcagaacgaaaccctgctggccgaggcgcgcatcgtcagc
ccgctgcgccatccgggcatcgtgccgatcttcgaggccggcgaggccgacggcgacgtc
tatctggtgttcgagtacgtccgcggcgagagtctcgccgcgcacatgcagcgcgaaggc
gcgctggcgccggtgcgcgccggcgaaatcctggtgcagatcctcgccgcggtcggccag
gcccacgccgagggcatcatccaccgcgacctcaagcccaccaacgtgctgatggacgaa
agcggcgcggtgcgggtgatggatttcggcatcgcctgccgtaccgccggcaagggcggg
caggccggctttgccggtacgccttcgtacatggcgccggagtacatcaccacgcgcgag
gtcagcgagcgtatcgacgtgttcgccgccggcgtgatcttcatcgagctgctgaccggc
cggcgcctgttcgccggcgacgacgtcgatcaggtgatgcagcgcatcgtcgcccgccag
gtggtgctgcccaccgacctggcgctggacgagcgcgtggccggcattgcgctgcgcgcg
gtggcgcgcgacccggccgagcgcttcgaatccgccgccgccttccgccaggcgctggaa
gcctggctgcagccggatgaagcggtgcagtcggcggaggcgcgccagagcacggtcgat
ttcctgctgcggcggatgcgccacaagagcgacttcccggcgctgtcggagtcggtgagc
gcgatcaaccgcatcgcatcgagcgagtccgagagcgtgtccaagctgtcggtgtcgatc
ctgcgcgacttctcgctgaccaacaagatcctgcggctggtcaattcggtggcttaccgc
caggccggcggcggcagcatcagtacggtgtcgcgcgcggtgatcgtgctcggtttcgac
acggtgcggaacatcgccatcaccgtgctgctgttcgaacacctgcagaacaaggccaac
gccagccagctcaaggaagacttcctgcgcgccaacctcgccggcatcctcgcccgcgac
atcgccagcaaggcccgcacgcgcgatctggagcagtccttcatctgcgccatcttccac
aacctgggccggctgctgacgcagttctactttcccgaggaaagcgaagaaatccgccgc
atgatggcgcagaagtcctgtaccgaggaggtcgccgcgctgcgcgtgctcggcctcagc
ttcgaggacctgggcatcggcatcgcgcgcagctggggttttccgacgctgatcgtcgac
agcatgcacaagctgccggccggcaaggtgcgcaagccggccacgcaggaggaccgcctg
cgcgtggtgtcggcgctgtcgaacgagatttccaccgcgatcgccacgctgtcgccggag
gagcgcgcgaaggagatgcagcgcatcgcggcacgtttcgcggaggcgcagccgctcgac
gacaccgagctgaaggacgcgatcaagcacgcgatcgaggagatcaccgagttcgcgcgc
atcatccgcatcaacctggggcagacccacttcggccagcagttgcggcgctacagcggc
ggcgagacgggcggcgagggcggcggcagcgacggcagcatgggctcggcggtgctcgag
cagaaccgctcgccggcgctggaaacgggcaacttcggcgaggaaggacgcaaggccgcc
gacgcccaggcagtgctcaccgccggcatccaggacatcagcaatacgctggtcgaggag
ttcaagctcaacgacatcctgcgcatcatcctcgagaccatgtaccgggcgatgggcttc
cgccgcgtgctgctgtgcatccgcgatgcgcgcagcaacaccatgcagggccgcttcggc
ttcggccccgaggtgaccgagctggccaagcagttccgtttcaccctcagcttcacgccc
gacatcttccacgccgccacctccaagggcgtggacatcctgatcagcgacgtcgacgac
gccaagatcgccgagcgcatcccggcgtggtttcgcaagggcgtcaccgccaagaccttc
gtgctgttcccgctgacgatcaagaacgcgccggtcgcgctgatctacgccgacaaggag
cacgccggcgagatcgagatcaccgagaaggaactgtcgctgttgcgcaccctgcgcaac
caggccgtgctggcgatcaagcagtccacctga

DBGET integrated database retrieval system