KEGG   Azoarcus olearius: dqs_1891Help
Entry
dqs_1891          CDS       T04423                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
aoa  Azoarcus olearius
Pathway
aoa03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:aoa00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    dqs_1891
Enzymes [BR:aoa01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     dqs_1891
DNA repair and recombination proteins [BR:aoa03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     dqs_1891
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_C DNA_ligase_A_M DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: ANQ84929
LinkDB All DBs
Position
2005931..2008576
Genome map
AA seq 881 aa AA seqDB search
MKAHDKRRDEARGMKPGAIAALAEYARKRDFSITAEPPVRGARPRAEGALGFVVQKHAAR
RLHYDFRLELDGTLKSWAIPKGPSLDPRVKRLAVHVEDHPLDYADFEGRIPQGQYGGGDV
IVWDRGLWQPRDPDPAAAYRAGKLSFHLLGEKLSGGWTLVRTRDGGSGDKAQWLLIKDAD
GAARPQSDYDVVVARPESVLTHAQLPARRDAAGAAGGEGAKKARVAALRGDAARNPAWIA
PELATAVEAPPPGEWRYELKFDGYRMLARVENGRARLYTRNHHDWTAKLAPLREAVESLG
ADSAWLDGEVVVTDAHGVPDFQALQNALELGRDVDLRYFLFDLPYLDGEDLRKLPLEARR
ARLRALLGAHDHPRLAYSEDFPVPPQDILASACELRIEGVIGKRAGSPYRSVRSTDWIKL
KCRQRQEFVIVGYSAPQGGRQGFGALLLAVHDEAAGGRLRYAGKVGSGFSGASLKALHQR
MQPLRRPTPALALPVDSSVTRGATWLEPRLLCEVAFAMWTRDGLVRHAVFQGLRDDKPAA
DAVRERALPATAVARIQGDGRDDEDAPAPTAKVPSNGVRAGARRSPGTLAGVAISNPDRV
IDAASGVTKGELATFYCRIGAQLLPHLAGRPLSILRAPTGIDGERFFQRHADKMSMAGVH
LLPPDLDPDGERLMMVDTLEGVVGAAQMGTIEFHTWNATADRIERPDRIVFDLDPDPALP
WSRMVEATRLVLTLLDEIGLDAFLKTSGGKGIHVVVPLARRHDWEALKQFSRAVTRHLAR
ILPQRFADRMGPQNRVGRIFVDYLRNQRAASTVSAYSVRARPGLAVSVPITRQELERIDG
ADQWTVRNLHQRLARLTRDPWEGYANRQVISAAMRAAVAAD
NT seq 2646 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcacacgacaaacgccgcgacgaagcgcgcggcatgaagccgggcgcgatcgcc
gctttggcggaatacgcccgcaagcgcgacttctcgatcaccgcggagccgccggtgcgc
ggcgcgcggccgcgcgccgagggcgcgctcggcttcgtcgtgcagaagcatgccgcgcgc
cggctgcactacgacttccgcctggaactcgacggcacgctgaagagctgggcgatcccc
aaggggccgagcctggatccgcgggtcaagcgcctggcggtgcacgtcgaagaccatccg
ctcgactacgccgacttcgagggccgcattccgcagggccagtacggcggcggcgacgtc
atcgtgtgggaccgcgggttgtggcagccgcgcgaccccgatcccgcggcggcctaccgc
gccggcaagctcagcttccacctgcttggcgaaaagctctccggcggctggaccctggtt
cgcacccgcgacggcggcagcggcgacaaggcgcagtggctgctgatcaaggatgcggac
ggcgctgcgcggccgcagtcggactacgacgtggtcgtcgcacggcccgagagcgtattg
acccacgcccaactgccagcgcggcgcgatgccgccggcgcggcgggcggcgagggcgcg
aagaaggcccgcgtggcagcgttgcgcggcgacgccgcgcgcaatccggcctggatcgcg
ccggaactcgccaccgcggtggaggcgccaccgccgggcgaatggcgctacgaactcaag
ttcgatggctaccgcatgctggcacgggtggaaaacggccgcgcgcggctctacacccgc
aaccatcacgactggaccgcaaaactggcaccgctgcgcgaggcggtggaaagcctgggc
gcggacagcgcctggctggacggcgaggtggtggtgaccgacgcccacggcgtgcccgat
ttccaggccctgcagaacgcgctggagctggggcgtgacgtggacctgcgctatttcctg
ttcgacctgccctacctggacggcgaggacctgcgcaagctgccgctggaagcgcgccga
gcccgcctgcgcgcactgctgggcgcgcacgaccatccgcggctggcgtattcggaggac
tttccggtgccgccgcaggacatcctcgccagcgcctgcgaattgcgcatcgagggcgtc
atcggcaagcgcgccggcagcccctaccgttcggtccgcagcaccgactggatcaagctc
aaatgccgccagcggcaggagttcgtgatcgtcggctacagcgcaccgcagggcgggcgc
caggggtttggcgccttgctgctggcggtgcacgacgaagccgcgggcgggcgcctgcgc
tacgccggcaaggtcggcagcggtttcagcggcgccagcctgaaggccttgcaccagcgc
atgcagccactgcgccgcccgaccccggcgctggcgctgccggtcgatagcagcgtcacc
cgcggcgccacctggctggagccgcgcctgctgtgcgaggtggcgtttgcgatgtggacc
cgcgacgggctggtgcgccatgcggtgttccagggcctgcgcgacgacaaacccgccgcc
gacgcggtgcgcgagcgcgcattgcccgccaccgccgtggcgcgcattcaaggtgacgga
cgcgatgacgaagacgcgccggcgccgaccgccaaggtgccgtcgaacggcgtccgcgcc
ggcgcgaggcgcagtcccggcacgctcgcgggcgttgcgatcagcaacccggaccgcgtc
atcgacgccgccagcggcgtgaccaagggcgaactcgccaccttctactgccgcatcggc
gcgcagctgctgccccatctggcggggcggccgctgtccatcctgcgcgcgcccaccggc
atcgacggcgaacgcttcttccagcgtcatgccgacaagatgtcgatggcgggtgtgcat
ctgctgccgcccgacctcgacccggacggcgagcgcctgatgatggtggatacgctggag
ggcgtggtcggcgcggcgcagatgggcacgatcgagttccacacctggaatgccaccgcc
gaccgcatcgagcgccccgaccgcatcgtgttcgacctcgaccccgaccccgcgctgccg
tggtcgcgcatggtggaggcgacccggctggtgctgacgctgctggacgaaatcgggctg
gatgccttcctgaagaccagcggcggcaagggcatccacgtggtggtgccgctcgcgcgg
cggcacgactgggaggcgctgaagcagttctcgcgcgcggtcacccggcatctcgcgcgc
atcctgccgcagcgctttgcggaccgcatggggccgcagaaccgggtagggcgcatcttc
gttgactacctgcgcaaccagcgcgcggcgagcacggtgtcggcctattcggtccgtgcg
cgccccgggctggcggtgtcggtgccgatcacccgccaggagctggagcgcatcgacggt
gccgaccaatggacggtgcgcaacctgcaccagcggctggcgcggctcacccgcgacccg
tgggagggctacgccaaccgccaggtgatcagcgccgcgatgcgggccgcggtggcggcg
gactga

DBGET integrated database retrieval system