KEGG   Azoarcus olearius: dqs_2398Help
Entry
dqs_2398          CDS       T04423                                 

Definition
(GenBank) putative glutathione transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
aoa  Azoarcus olearius
Pathway
aoa00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:aoa00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    dqs_2398
Enzymes [BR:aoa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     dqs_2398
Transporters [BR:aoa02000]
 Other Transporters
  Pores ion channels [TC:1]
   dqs_2398
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_2 GST_C Tom37
Motif
Other DBs
NCBI-ProteinID: ANQ85429
LinkDB All DBs
Position
complement(2556751..2557380)
Genome map
AA seq 209 aa AA seqDB search
MNELVLYTHPYSRGRIAHWMLEEVGQPHRIEWAEFGPAMKTPEFLALNPMGKVPVLTHGD
VVVTEAAAICAYLADRFPDSGLAPAAHDSARGPWYRWLFFAAGPVEQAVTAHSMGWQVPE
GKDAFVGFGSYARVLDTLEKAVSAAPYLCGEFSAADVYVGSHLGWGMMFGSIEKRPAFEE
YVARLQARPAAQRADRINAERIETMQKKA
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaactggttctatacacccatccctattcgcgcggacgtatcgcccactggatg
ctggaagaggtcgggcagccgcaccgcatcgagtgggccgaattcggcccggcgatgaag
acgccggagttcctggcgctcaatcccatgggcaaggtgccggtgctgacccacggtgat
gtggtcgtcaccgaggcggcggcgatctgcgcctacctcgccgaccgctttccggatagc
gggctggcgccggccgcgcatgactccgcgcgcggcccctggtaccgctggctgttcttc
gccgcggggccggtggagcaggcggtgaccgcgcattcgatgggctggcaagtgccggag
ggcaaggatgccttcgtcggcttcggcagctacgcgcgcgtgctcgacacgctggagaag
gccgtctccgcggcaccgtacctgtgcggcgagttcagtgcggcggatgtgtacgtcggt
tcccatctcggctgggggatgatgttcggcagcatcgaaaagcgcccggcgttcgaggaa
tacgtcgccaggctgcaggcgcggccggcggcacagcgtgccgaccgcatcaacgccgag
cgcatcgaaaccatgcagaagaaggcctga

DBGET integrated database retrieval system