Azoarcus olearius DQS4: dqs_2495 Help Entry dqs_2495          CDS       T04423                                  Name (GenBank) chaperonin GroES   KO K04078   chaperonin GroES Organism aoa  Azoarcus olearius DQS4 Brite KEGG Orthology (KO) [BR:aoa00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:aoa03110]     dqs_2495    03029 Mitochondrial biogenesis [BR:aoa03029]     dqs_2495 Chaperones and folding catalysts [BR:aoa03110]  Heat shock proteins   HSP10    dqs_2495 Mitochondrial biogenesis [BR:aoa03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     dqs_2495 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cpn10 Motif Other DBs NCBI-ProteinID:  ANQ85525 LinkDB All DBs Position 2668241..2668528 Genome browser AA seq 95 aa AA seqDB search MAIRPLHDRVIVKRLEAERTTASGIVIPDSAGEKPDQGEVIAVGRGKILDNGELRAPQLK AGDRVLFGKYAGQAVKIDGEEVLVVREEDIFGVIE NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atggctatccgccccctgcacgaccgcgtcatcgtcaaacgcctcgaagccgaacgcacc accgccagcggcatcgtcattcccgattccgcgggcgagaagcccgaccagggcgaggtc atcgccgtcggccgcggcaagatcctcgacaacggcgaactgcgcgcgccgcagctcaag gccggcgatcgcgtgctgttcggcaagtacgccggccaggcggtgaagatcgacggcgaa gaagtgctcgtcgtgcgcgaagaagacattttcggcgtcatcgaataa

DBGET integrated database retrieval system