KEGG   Azoarcus olearius: dqs_3070Help
Entry
dqs_3070          CDS       T04423                                 

Definition
(GenBank) aldehyde ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
aoa  Azoarcus olearius
Pathway
aoa00030  Pentose phosphate pathway
aoa01100  Metabolic pathways
aoa01120  Microbial metabolism in diverse environments
aoa01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:aoa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    dqs_3070
Enzymes [BR:aoa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     dqs_3070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: ANQ86098
LinkDB All DBs
Position
complement(3299792..3301639)
Genome map
AA seq 615 aa AA seqDB search
MGWNRKVLRVNLTAGTCTEEPLNMEWAQEYLGSRGLATKYLVEEIDPKVDPLSPENKMIM
ATGPLTGTMASTGGRYTVVTKGALTGAIACSNSGGFFGAELKFAGWDMVIFEGKSPKPVY
LYIENDKAELRDAGHLWGKSCWETEETIKHELQDPLVRVSSIGSAGENQVLFACVVNDLH
RAAGRSGVGAVMGSKNLKAVALRGTQGVSGIKDFGAFLQATTAAKKVLADNAVTGEGLPK
YGTQVLMNVINEMGALPTRNHRDVQFEDAGKISAEAMHEKRPTDGKAHLVTNAACFGCTI
ACGRISEIDKGHFTVKNSPKYWGASGGLEYEAAWALGAANGVGDLEALQYANLICNEQGM
DPISFGATIGAVMELYEMGVLTKEQIGIDAPFGSAEALARLVEMTANGEGFGKEIGLGSK
RLCAKYGHPELSMSVKGQEFPAYDSRGVQGIGLAYATSNRGACHLRGYTIASEVLGIPVK
TDPHATEGKPELVKAFQDATAVFDAAGICVFTSFAWTLADVQPQLAAACEGDWSMEKLNE
VGERIWNMERRFNNAAGFTAADDNLPPRLTSEPAKSGPAKGMVNELSKMLPEYYKVRGWT
PEGAPTAETLARLGL
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atgggctggaaccgtaaagtcctgcgggtgaacctgaccgcgggcacctgcaccgaagaa
ccgctgaacatggaatgggcgcaggaatacctgggctcgcgcggtctggcgaccaagtac
ctggtggaagagatcgatcccaaggtcgatccgctgtcccccgaaaacaagatgatcatg
gccaccgggccgctgaccggcaccatggcctccaccggcggccgctacaccgtggtgacc
aagggtgcgctcaccggtgcgatcgcgtgctccaactcgggcggcttctttggcgcggag
ctgaagttcgccggctgggacatggtgattttcgaaggcaagtcgccgaagccggtgtac
ctgtacatcgaaaacgacaaggccgaactgcgcgacgccggccacctgtggggcaagagc
tgctgggaaaccgaggaaacgatcaagcacgagctgcaggatccgctggtgcgcgtgtcc
tcgatcggcagcgcgggtgaaaaccaggtgctgttcgcctgcgtggtgaacgatctccac
cgtgccgccggccgctccggcgtgggcgcggtgatgggctcgaagaacctcaaggcggtc
gcgctgcgcggcacccagggcgtctccggcatcaaggacttcggcgccttcctgcaggcg
accaccgcggccaagaaagtgctcgccgacaacgcggtcaccggcgaaggtctacccaag
tacggcacccaggtgctgatgaacgtcatcaacgagatgggtgcgctgcccacgcgcaac
caccgcgacgtgcagttcgaggacgcgggcaagatctccgccgaggcgatgcacgagaag
cggccgaccgacggcaaggcccacctcgtcaccaatgccgcctgcttcggctgcaccatc
gcctgcggccgcatctccgagatcgacaagggtcacttcacggtcaagaacagcccgaag
tactggggcgcctccggcggcctggagtacgaggccgcgtgggcgctgggcgccgccaac
ggcgtgggcgatctggaggcgctgcagtacgccaacctgatctgcaacgagcagggcatg
gacccgatctccttcggcgccaccatcggtgcggtgatggagctgtatgagatgggcgtg
ctgacgaaggagcagatcggcatcgacgcgcccttcggctcggcggaagcgctggcgcga
ctggtggagatgaccgccaacggcgaaggcttcggcaaggagatcggcctcggctcgaag
cggctgtgcgccaagtacggccatccggaactgtcgatgagcgtgaagggccaggagttt
ccggcttacgactcgcgcggcgtgcagggcatcggcctcgcctatgccacttccaaccgc
ggcgcctgccacctgcgcggctacacgattgcctccgaagtgctcggcattccggtgaag
accgacccgcacgccaccgaaggcaagccggaactggtcaaggccttccaggacgccacc
gcggtgttcgatgccgccggcatctgcgtgttcaccagcttcgcgtggacgctggccgac
gtgcagccgcaactcgccgccgcgtgcgaaggcgactggagcatggagaagctcaacgaa
gtgggcgagcggatctggaacatggagcgccgcttcaacaacgccgccggcttcaccgcc
gccgacgacaacctgccgccgcgcctgaccagcgagcccgccaagtccggtcccgccaag
ggcatggtgaacgagctgtccaagatgctgcccgagtactacaaggtgcgcgggtggacc
cccgagggtgcccccaccgccgaaacgctcgcgcggctggggctgtaa

DBGET integrated database retrieval system