KEGG   Azoarcus olearius: dqs_3157Help
Entry
dqs_3157          CDS       T04423                                 

Definition
(GenBank) putative quinoprotein ethanol dehydrogenase
  KO
K17760  quinohemoprotein ethanol dehydrogenase [EC:1.1.9.1]
Organism
aoa  Azoarcus olearius
Brite
KEGG Orthology (KO) [BR:aoa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    dqs_3157
Enzymes [BR:aoa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.9  With a copper protein as acceptor
    1.1.9.1  alcohol dehydrogenase (azurin)
     dqs_3157
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PQQ PQQ_2 PQQ_3 Cytochrome_CBB3 Cytochrom_C
Motif
Other DBs
NCBI-ProteinID: ANQ86185
LinkDB All DBs
Position
3402493..3404604
Genome map
AA seq 703 aa AA seqDB search
MTRTTLALTLLLTTTPTLAAPPANVDGQRIARIATGGEAANWLSHGRGYDEKRYSPLKKI
NDANVGKLGLAWTHKLDIDMGVEATPIVVDGVMYTTGPYSIVYALDAVSGKLLWKHDPKV
PKAMAGEGCCGPVNRGVAVWKGRVYVGTFDGRLVALDAASGKQVWSVDTVLDHAKSYTIT
GAPRIVKGKVLIGNGGAEFGVRGYVTAYDAETGKQAWRFFTVPGDPKLPPEDDAMAMALK
TWYGDGWIKWGGGGTVWDSMSYDPELNQLYIGVGNGSPFNYQFRSKGKGDNLFLSSVVAL
DPDTGKYIWHYQTTPADRWDFTAAQQMTLADIEIDGKVRKVLMQAPKNGFFYVLDRTNGQ
LISAKNIVPVNWASHIDLATGRPVLLPDADYADGAKLIAPAIIGGHNWHPMSYSPDTGLV
YIPAQETAAALEAQKEPLFIPSKAVVNIGLNVPDLPEDPAIVDKISQSWRGRLVAWDPVK
QEARWSQEYRTIYNGGTLATAGNLVFQGTADGRVVAYAADSGKLLWQSPANTGVMAGPVT
FEVKGEQYVSFMAGWGGTFPRILGPLSLAAKVKPESRILTYKLGGKATLPAAKFDTVPLP
PPPPVTLEADKMPMARMLFNGFCANCHGLNAVSGGVVPDLRYLTADKHAQFNAIVAGARA
ERGMPSLASALLPEHMEMIHQYIVKRANDLKGELEAVKAAGKQ
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcacaacgctagccctcaccctgctcctcaccaccacccccaccctcgccgcc
ccacccgccaacgtcgacgggcaacgcatcgccagaatcgccaccggcggcgaagccgcc
aactggctgtcccacggccgcggctacgacgagaaacgctattccccgctgaagaagatc
aacgacgccaacgtcggcaagctcggcctcgcctggactcacaagctggacatcgacatg
ggcgtggaggccacccccatcgtggtcgatggcgtgatgtacaccaccggcccctacagc
atcgtctatgcgctcgacgcggtgagcggcaagctgctgtggaagcacgaccccaaggtg
cccaaggcgatggccggcgaaggctgttgcggtccggtcaaccgcggcgtcgcggtgtgg
aagggcagggtctatgtcggcaccttcgacggccggctggtggcgctcgacgccgccagc
ggcaagcaggtgtggtcggtggataccgtgctcgaccatgcgaagagctacaccatcacc
ggcgcgccgcgcatcgtcaaaggcaaggtgctgatcggcaacggcggcgccgagttcggc
gtgcgcggctacgtcaccgcgtatgacgcggaaaccggcaagcaggcctggcgcttcttc
accgtgccgggcgaccccaagctgccgccggaagacgacgccatggcgatggcgctgaag
acctggtacggcgacggctggatcaagtggggcggcggcggcaccgtgtgggattcgatg
tcctacgacccggagctgaaccagctctacatcggcgtcggcaacggctcgcccttcaac
taccagttccgcagcaagggcaagggcgacaacctgttcctgtcctcggtggtggcgcta
gacccggacaccggcaaatacatctggcactaccagaccacgcccgccgaccgctgggac
ttcaccgccgcgcagcagatgacgctggccgacatcgagatcgacggcaaggtccgcaag
gtgctgatgcaggcgccgaaaaacggcttcttctacgtgctcgaccggaccaatggccag
ctgatttcggcgaagaacatcgtgccggtgaactgggccagccacatcgacctcgccacc
ggacgcccggtgctgctgccggacgccgactacgccgacggcgccaagctgatcgcgccg
gcgatcatcggcggccacaactggcatccgatgtcctacagcccggacaccggcctggtc
tacatcccggcgcaggaaaccgccgccgcgctggaagcgcagaaggaaccgctgttcatc
cccagcaaagcggtggtgaacatcggcctcaacgtgcccgacctgccggaagacccggcc
atcgtcgacaagatcagccagtcctggcgcggccgcctggtcgcgtgggacccggtgaag
caggaggcgcgctggagccaggaataccgcaccatctacaacggcggcacgctcgccacc
gccggcaacctggtgttccagggcaccgccgacggccgcgtggtggcctacgccgccgac
agcggcaaactgctgtggcagtcgccggccaacaccggcgtgatggccggtccggtcacc
ttcgaagtgaagggtgagcagtacgtcagcttcatggccggttggggcggcaccttcccg
cgcatcctcggcccgctgtcgctggcggccaaggtgaagccggagtcgcgcatcctcacc
tacaagctcggcggcaaggccacgctgccggcggcaaagttcgacaccgtgccgctgccg
ccgcccccgccggtgacgctggaagccgacaagatgccgatggcccgcatgctgttcaac
ggcttctgcgccaactgccacggcctcaacgcggtgagcggcggcgtggtgcccgacctg
cgctacctcaccgccgacaagcacgcgcagttcaacgccatcgtcgccggcgcgcgcgcc
gagcgcggcatgccctcgctcgccagcgcgctgctgcccgagcacatggagatgattcac
cagtacatcgtgaagcgggcgaacgatctgaagggggaactggaggcggtgaaggcagcc
gggaagcagtaa

DBGET integrated database retrieval system