KEGG   Amphiprion ocellaris (clown anemonefish): 111563233
Entry
111563233         CDS       T06018                                 

Definition
(RefSeq) ras association domain-containing protein 1-like
  KO
K09850  Ras association domain-containing protein 1
Organism
aoce  Amphiprion ocellaris (clown anemonefish)
SSDB
Motif
Pfam: Nore1-SARAH RA C1_1 C1_2
Other DBs
NCBI-GeneID: 111563233
NCBI-ProteinID: XP_023117975
Ensembl: ENSAOCG00000003215
LinkDB
Position
Unknown
AA seq 355 aa
MSKCELIELKDLSVNDPIELAAPTVHVAPPPVNPGHPSPYHIVRLVGDSVSIEAPGYHTG
ETGVGHDFQPYSHTHLTWCDLCGEFIWGVYKQSLRCANCSYTCHYRCRAFIQLDCSTHES
VFTEPVDDSIETDTNVDEKIELGKQELSAAEIQQRVKEYNAQINSNLYMVDNKDGSYTGF
IKVHFQLLRPISLPPPQSLTSTQEDDQPGRRMSRRTSFYLPKDTAKHLHISSETRVREVI
EALLNKFTVVDNPAKFALFERTERQSQVYMRKLSDDERPLYLRLCAGPNETVLSLVLKEN
ETGEVNWDAFSFPELCNFLRILQREEEEHVRQIVKRYALARDRMKQAMARITTPG
NT seq 1068 nt   +upstreamnt  +downstreamnt
atgtctaaatgtgagctgattgagctgaaggacctcagtgtaaatgatcccattgaactg
gctgctccgactgtccacgtggccccaccgcctgtgaaccccggtcaccccagcccctac
cacatcgtccgtttggtgggagacagcgtcagcattgaggcgcccgggtatcacactggt
gaaactggtgtgggtcatgacttccagccctacagtcacacccatctgacctggtgtgac
ctctgtggagaattcatctggggtgtttataagcagagtttacgctgtgccaactgcagc
tacacttgtcactaccgctgccgagcattcatccaactggactgcagcacacatgaaagt
gtgttcacagagcctgtagatgactccatcgagacggatacaaatgtggatgaaaagatc
gaactgggtaaacaggagttaagtgctgctgagattcaacagagagtcaaggagtacaat
gctcagatcaacagcaatctctacatggtggataataaagacggatcctacactggcttc
atcaaggtccactttcagttacttcgtcccatctccctccctcctcctcagagcctcacc
tcgacgcaggaggacgaccagccgggcagacggatgagtcgtcggacatctttctacctc
cccaaagacactgcaaaacacctacacatcagctctgaaacgagggtgcgagaggtgatc
gaggcgctgctcaacaagttcactgtggtggacaacccagcaaagtttgccttgtttgaa
cgcacagagagacaaagtcaagtgtacatgcgtaaactgtctgatgatgaacgtcctctt
tatctgcgcttgtgtgccggacccaatgaaacagtgttgagtctggttttgaaggagaat
gaaactggagaagtaaattgggatgcatttagctttcctgagctctgcaacttcctgcga
atcttgcagcgtgaggaagaggagcacgtacggcagattgtgaagcgctatgctcttgct
agagacaggatgaagcaggcgatggccagaataactactcctggttga

DBGET integrated database retrieval system