KEGG   Amphiprion ocellaris (clown anemonefish): 111565142
Entry
111565142         CDS       T06018                                 

Definition
(RefSeq) glucocorticoid receptor-like
  KO
K05771  glucocorticoid receptor
Organism
aoce  Amphiprion ocellaris (clown anemonefish)
Pathway
aoce04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:aoce00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    111565142
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:aoce03000]
    111565142
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:aoce03310]
    111565142
Transcription factors [BR:aoce03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    111565142
Nuclear receptors [BR:aoce03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   111565142
SSDB
Motif
Pfam: GCR Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 111565142
NCBI-ProteinID: XP_023120919
Ensembl: ENSAOCG00000019197
LinkDB
Position
Unknown
AA seq 782 aa
MDKGGVKKIAYRKDEHLSKLVYTESPEEGGLLKVAPRSAISITSATSVILPSSSLMQPGQ
VPNGLSNSPLPEELTSTSVTATVGSLLDGPETRGLTKDQRLQQQQLLQTQTSTTFGRQNL
ADNLPHVEASVANITQSSMDSLIGGSDPNFFHMKTEDFSMDKGDQDPIDLDHPFGIGKDV
DVNQKLFSDNALDLLQDFDLTGSPSDFYVGDDAFLSTLTDDSLLGDVSSEKDMKPAVVES
SNTTLAVTVALNGSNMTNPDQSSSCISTTASLTSTTTLSALVKKEKDASFIQLCTPGVIK
REKTSAGHSYCQMSDSSSADMPGTNSISICGVSTSGGQSYHFGVSARNNEAQQQKDQKSV
TSLYLPVTTIGGAWNRGQGVGDNLAMHRASEAFSSSPSFPSTFARQEGGTAASSAQGKSG
GHKICLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPAC
RFRKCLMAGMNLEARKTKKLNRLKGANMSNPPEVTPSLPIEARSLVPKCMPQLVPTMLSL
LKAIEPDTIYAGYDSTLPDTSTRLMTTLNRLGGRQVISAVKWAKALPGFRNLHLDDQMTL
LQCSWLFLMSFGLGWRSYQQCNGNMLCFAPDLVINEERMKLPYMADQCEQMLKISSEFVR
LQVSHDEYLCMKVLLLLSTVPKDGLKSQTVFDEIRMSYIKELGKAIVKREENSSQNWQRF
YQLTKLLDSMHEMVGGLLSFCFYTFVNKSLSVEFPEMLAEIISNQLPKFKAGSVKPLLFH
QR
NT seq 2349 nt   +upstreamnt  +downstreamnt
atggacaaaggtggagtgaagaagatagcatacagaaaagatgaacatttaagcaaactg
gtctacactgaaagcccagaggagggaggtctgttgaaagtggctcctcgcagtgccata
tccatcacctctgccacctctgtcatccttccatccagctcattgatgcagccaggacag
gtgcccaacggcctcagcaacagcccccttccagaggagctcacctccacctctgtcact
gccactgtaggctccctgttagacggcccagagaccaggggcctgaccaaagatcagagg
ttgcagcagcagcagttacttcagacacagacttccactacttttgggcgtcaaaacttg
gcagacaatttgccccacgtggaagccagtgtagcgaacattacccagtcctccatggat
tcacttattggaggatcagatcccaatttcttccatatgaaaacagaggatttctccatg
gataaaggagaccaggaccccattgaccttgatcatccattcgggattgggaaggatgtg
gacgtgaaccagaagttgttcagtgacaatgctctggacctgcttcaagactttgacctc
actgggtccccctcagatttttatgtaggggatgatgcctttctgtccactctgacagat
gattctttgcttggggatgttagctcagagaaggacatgaagcctgcagtggttgagagc
agtaacaccactctggcagtcactgttgcccttaatggcagcaacatgacaaatccagat
cagtccagctcctgcatatccacaactgcttccttaacctccacaaccactttgtctgct
ttggtgaaaaaagaaaaagatgccagcttcattcagctctgtaccccaggtgtgattaaa
cgggagaagacatctgcaggccacagttattgccaaatgagcgactcgtcctctgcagac
atgcctggcactaactccatctccatctgtggggtcagtacttcaggaggacagagttac
cactttggagtcagtgccagaaacaacgaagctcagcagcaaaaggatcaaaagtcagtg
accagcctgtatctcccagtaacgaccatcggtggggcctggaacagaggccagggtgtt
ggggacaacctggcaatgcacagggccagtgaggctttctcaagttctccatccttcccc
tccacctttgccagacaagaagggggcaccgctgcatcctcggcacagggaaagagcgga
ggtcataaaatctgtctggtttgctcggacgaggcttcaggctgccactatggcgttctc
acctgtggcagctgcaaggtcttcttcaagagagcagtggaagggcagcataattacctg
tgtgccgggaggaatgactgcataatagacaagatcaggaggaagaactgccctgcgtgc
cgcttccgcaagtgtctgatggcaggcatgaacctggaagctcgcaaaaccaagaagttg
aatcgcttaaagggtgccaacatgagcaacccgcccgaggtgacaccttctctgccaatt
gaggctcgttcccttgtgcccaagtgtatgcctcaacttgtccccacaatgctgtccctg
ctgaaggccatcgagccggacaccatctacgccggctacgacagcaccctgcccgatacc
tccacccgcctcatgaccaccctcaacaggctgggtggccggcaggtcatctctgctgtc
aagtgggccaaggctctaccaggattcaggaacctgcaccttgatgaccagatgactcta
ctgcagtgctcctggctcttcctcatgtcttttggtctgggatggaggtcttaccaacag
tgcaacggcaacatgctgtgctttgcgccagaccttgtcatcaatgaggagcggatgaag
ctgccctacatggccgaccagtgcgagcagatgctgaagatttctagcgagtttgtccgg
ctgcaggtttcccacgacgagtacctgtgcatgaaggtcctgcttctgctcagcacagtg
ccaaaggacggcctgaagagccagacggtgttcgatgagattcggatgtcgtacatcaag
gagctgggcaaagccatcgtgaagcgcgaggagaactccagccagaactggcagcgtttt
taccagctcacaaagctactggactccatgcatgagatggtcggaggattgctcagcttc
tgcttctacacctttgtgaataaatcgctgagcgtggagttcccggagatgctggcggag
atcatcagcaaccagttaccaaaattcaaggccgggagcgtgaaacccctcctcttccac
cagagatga

DBGET integrated database retrieval system