KEGG   Amphiprion ocellaris (clown anemonefish): 111567558
Entry
111567558         CDS       T06018                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: putative fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
aoce  Amphiprion ocellaris (clown anemonefish)
Pathway
aoce04010  MAPK signaling pathway
aoce04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:aoce00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111567558
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111567558
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:aoce04052]
    111567558
   00536 Glycosaminoglycan binding proteins [BR:aoce00536]
    111567558
Cytokines and growth factors [BR:aoce04052]
 Growth factors
  Growth factors (RTK binding)
   111567558
Glycosaminoglycan binding proteins [BR:aoce00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   111567558
SSDB
Motif
Pfam: FGF Fascin Herpes_LMP2
Other DBs
NCBI-GeneID: 111567558
NCBI-ProteinID: XP_023124520
Ensembl: ENSAOCG00000016173
LinkDB
Position
Unknown
AA seq 153 aa
MADGEICALQEQTAGCGLLLPDYRRLTRLYCMNGGHHLQILPDGTVQGQRDDGDAHIVLK
LKAVNIGVVVIQGTEAGXYLAMNDEGRLYSSPTVTDECYFLEKLEENHYNTYQPQKYQDQ
NWYVGLKKNGKPKLGPRTHIGQKAIFFIPRQLE
NT seq 462 nt   +upstreamnt  +downstreamnt
atggcggatggagagatatgcgcactgcaggagcagactgcgggctgcggcctgctgctg
ccggactaccgccggctgacgcggctctactgcatgaatggcggacaccacctccagatc
ctccccgatgggacggtgcagggccagagggacgacggggacgctcacattgttttgaag
ctcaaagctgtgaacatcggcgtcgtggtcatccagggaacagaagcaggatgatatctg
gccatgaatgatgaagggcgtttgtacagctcacccacagtaacggatgaatgctacttc
ctggagaaactggaggagaatcactacaacacatatcagccacagaaatatcaggaccag
aactggtacgtaggtctgaaaaagaatggaaaacctaaattgggtccaaggacccacatt
ggacagaaggccatcttctttatacccagacagctggaatga

DBGET integrated database retrieval system