KEGG   Amphiprion ocellaris (clown anemonefish): 111568072
Entry
111568072         CDS       T06018                                 

Definition
(RefSeq) TGF-beta receptor type-2-like
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
aoce  Amphiprion ocellaris (clown anemonefish)
Pathway
aoce04010  MAPK signaling pathway
aoce04060  Cytokine-cytokine receptor interaction
aoce04068  FoxO signaling pathway
aoce04144  Endocytosis
aoce04218  Cellular senescence
aoce04350  TGF-beta signaling pathway
aoce04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:aoce00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111568072
   04350 TGF-beta signaling pathway
    111568072
   04068 FoxO signaling pathway
    111568072
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111568072
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    111568072
  09143 Cell growth and death
   04218 Cellular senescence
    111568072
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    111568072
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aoce01001]
    111568072
Enzymes [BR:aoce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     111568072
Protein kinases [BR:aoce01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   111568072
SSDB
Motif
Pfam: ecTbetaR2 PK_Tyr_Ser-Thr Pkinase Insulin_TMD
Other DBs
NCBI-GeneID: 111568072
NCBI-ProteinID: XP_023125311
Ensembl: ENSAOCG00000017023
LinkDB
Position
Unknown
AA seq 575 aa
MMVRCFWTGTLVLLAAGLPVVAESFSHLSYNLCKWCEVSSPVCKDNVCLSNCNLSSFCTV
MEEICIAIWRKTNYTVTVHTMCHHQTLPLEGVDPGLLLNFTTRECHMVQQPAEEGTMMVC
GCHGEHECNDKLIFEKGANGFSRLHSKDVIPVVVVSLVPPVLVALVATAAFYFYRIRRPD
KPGPPARPDWPTKRTPELYQALDLQGQGTQREHGSLMGPGGGDEYNAKVPSPHDDTIRDV
TDWQGQPAELLPIKLEVLVGKGHFAEVWKGRLLEAERGGVSSYDTVAVKVFPAVEYASWR
NECSIFSDPELQHENVVQFLAAEERGSPGHALRSYWLVLAYHSLGNLQAFLTANILSWEE
LVAMAGSIAKGLAHLHSDTTPSGAPKVPVAHRDLKGSNIVVKSRNECALCDFGLALRLDL
SLTVDDYANSGQVGTARYMAPEVLESRVNLEDLEAFKQMDVYSMALVLWEMASRCHAIGE
VKSYEPAFGSKVCEQPCVDSMRDLVLRDRGRPDIPSTWTQHQGMNIFCSTITECWDHDPE
ARLTAHCVVERLSALQQAQEEEEEEEEEEEEEQEE
NT seq 1725 nt   +upstreamnt  +downstreamnt
atgatggttcggtgcttctggaccgggaccctcgtcctgctcgcagccggtcttccagtt
gtcgccgagtctttcagccacctgagctacaacttgtgtaaatggtgtgaagtttccagt
ccggtatgtaaagacaacgtctgcctcagtaactgcaatctgtcgtccttctgcaccgtc
atggaggagatctgcatcgcaatatggaggaaaaccaactacacggtgacggtgcatacg
atgtgtcaccaccagactctgcctctggagggcgttgaccccggactgctgcttaacttc
accaccagggagtgtcacatggtccagcagccggccgaggagggcaccatgatggtctgt
ggctgccacggcgagcacgaatgtaacgacaagctcatcttcgaaaagggagccaacggt
ttctccaggctgcacagtaaagacgtgatcccggtggtggtggttagtctggtgcctcct
gtcctggttgctctggtcgccaccgccgccttctacttctaccgcatacgccgccccgac
aaaccaggccctcctgcacgccccgactggccgaccaaacgcaccccagagctctaccag
gctttggacctgcagggtcaaggcactcagagggaacatggaagtctgatgggtcctggt
ggcggcgacgagtacaacgccaaggtaccgtctcctcatgatgacaccatccgcgatgtg
acggactggcagggccaaccggccgaactgctgcccatcaagctggaggttctggtgggg
aaggggcacttcgctgaggtgtggaagggtcggctgctggaggctgagcggggcggagtc
agcagctatgacaccgtggcggtgaaggtgtttccagccgtggagtacgcctcctggagg
aacgagtgctccattttctctgacccggagctgcagcatgaaaacgtggttcagttcctg
gcggctgaggaaaggggttcgccgggccacgccctccggtcctactggctggttctggcc
tatcacagccttggaaacctgcaggctttcctcactgcgaacatactgagctgggaggaa
cttgttgccatggcaggaagcattgctaaaggattagctcacctccacagcgacacgacg
cccagtggggcaccaaaggttccagttgcccatcgggacctaaagggcagcaacatcgtg
gtgaagagcaggaacgagtgtgcactgtgtgactttggtctggcgttaagactggatctc
tccctgacagtcgacgactacgccaacagtggacaggtggggacggctcgctacatggct
cctgaggtgctggagtccagggtgaacctggaggacctggaggccttcaaacagatggat
gtttactccatggctctggtcctgtgggagatggcgtcccgctgccacgccatcggagag
gtgaagagctacgagccagcgtttggctctaaggtttgtgaacagccctgtgtggacagc
atgagggatctggtgttgagggaccgaggacgaccggacatcccctcgacgtggacacag
catcaggggatgaacatcttctgctccaccatcactgaatgttgggatcacgatcctgaa
gccagactgacggctcactgtgtggtggagagactcagcgccctgcagcaggcccaggag
gaggaggaggaggaggaagaggaggaggaggaagaacaggaggaa

DBGET integrated database retrieval system