KEGG   Amphiprion ocellaris (clown anemonefish): 111568555
Entry
111568555         CDS       T06018                                 

Gene name
atf6b
Definition
(RefSeq) LOW QUALITY PROTEIN: cyclic AMP-dependent transcription factor ATF-6 beta
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
aoce  Amphiprion ocellaris (clown anemonefish)
Pathway
aoce04141  Protein processing in endoplasmic reticulum
aoce04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:aoce00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    111568555 (atf6b)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    111568555 (atf6b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:aoce03000]
    111568555 (atf6b)
Transcription factors [BR:aoce03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    111568555 (atf6b)
SSDB
Motif
Pfam: bZIP_1 SUIM_assoc bZIP_2 YabA bZIP_Maf MCU DUF4140
Other DBs
NCBI-GeneID: 111568555
NCBI-ProteinID: XP_023126015
Ensembl: ENSAOCG00000002786
LinkDB
Position
Unknown
AA seq 709 aa
MSSDLDLDLDLNKRFFADNLLTSEDWDACLYQCESMEDDGDFSRGLKYDASFDNDLVLTL
DPDNPTSPWQHLHDNLLTGEAPVIKNEMTITQPLPVEMLFQVKAEPPSPASSLGSDCSPS
SPDPQITVKGENPPTPPYMYGDVLSPPLGSMEVTVATTAAPPPQVPAATQIPATTQLQAA
ITAIPAVISGIQTQAAVLPGSATLKASSILSTKPPIQPRPVCVATLPVPQTPTPAKTLIL
QGLPSMDQSRPVVLSPSVCLGSAPAIVKMEPVSPSMPCSSPTAPPTSKPIVPATTTLPGN
NSSDIDMKVLKRQQRMIKNRESACQSRKKKKEYLQNLEAQLREAQQENERLRRENQALRE
RLAGKEGSDSASNKRAVCVMAVLLFMTFSFGPVSITDRKLSTVLQDDVVSFSGRRLLEIQ
QQQQQQQQQQVAAPPPSSVEDKTEAEEEGGEEERYAAESYQFRNLSDMFSDVKDLVLQDI
DRYFSSSDCRQFNRSESLRLADELRGWVHRHQIDRKKSGGKPKIAKKARIAQKAQQRKTN
ISRYLPIQAHRSIESQLQVLPGPEVTYSDFLDAIDRREDTFYVVSFRRDHLLLPAISHNK
TSRPKMSLVMPAMSVNESLYNSSQGYEMMMQVDCEVMDTRIVPIKSSAVPPSLRDPPPRP
PSPHHHHGNHTSLRGRHHSSSSSPSSSPRQRLPTRRRTGEYLISQSEGV
NT seq 2130 nt   +upstreamnt  +downstreamnt
atgagctccgatcttgacctggacctagacctgaacaagaggttcttcgctgataacctg
ctgaccagcgaggactgggatgcctgcctgtaccagtgtgaaagcatggaggatgacgga
gacttcagccgtgggctgaaatacgacgcatcgtttgacaacgacctcgtgctcacactc
gatcccgacaaccccacgtcgccatggcaacaccttcacgacaaccttctcacaggagaa
gctccagtgataaagaatgaaatgacaataacacagcctttaccggtggaaatgctgttc
caggtgaaagcagagcctccctctccagcgtcctcactgggatccgactgttctccatca
tctccagacccacagatcacagttaaaggtgaaaaccctccgactcctccgtacatgtac
ggtgacgtgctgtcgcctccgctgggatccatggaggtaactgtggcaacgactgcagcg
cccccgccacaggttcctgcagcgacgcagattcctgcaacaacgcagctccaggcagcg
ataacagcgatcccagcggtcatcagtggaatacagacgcaggcagcagtgctgccgggc
tcggccacattaaaagccagctccatcctgagcaccaaacctcccatccagcccagaccg
gtgtgtgtcgccactctccccgtcccccagacccccacaccagccaagaccctgatcctg
caggggctcccctccatggaccagagccggcctgtcgtcctttctccgtccgtctgcctc
ggttcagctccggccatcgtaaagatggagcccgtctctcccagcatgccttgctccagc
cccacggccccgcccaccagcaaacccatcgttccggcaaccaccacgttacctgggaac
aactccagcgacatcgatatgaaggtcctgaagcggcagcagaggatgatcaagaaccgg
gagtcggcctgccagtccaggaagaagaagaaggagtacctgcagaacctggaagctcag
ctgagggaggcccagcaggagaacgaacgcctccgcagggagaaccaggcgctgagggag
agactggctgggaaggagggcagcgactcggcgagcaacaagagagccgtgtgtgtgatg
gccgttctgctcttcatgaccttcagctttggacccgtcagcatcacagacaggaagctg
tccacggttctgcaggacgacgtggtgtcattttcaggacgacggctgctggagatccaa
caacaacaacaacaacaacaacagcagcaggtggcagctccacctcccagcagcgtcgag
gacaagacggaggcagaggaggaaggaggagaagaagaaagatacgctgcagagtcttat
cagttcagaaacctgagcgacatgttcagtgatgtgaaagacctggttctgcaggacatc
gaccgttatttcagctcctcagactgccggcagttcaaccgctccgagtccctcaggctg
gcagacgagctcagaggttgggttcatcgacatcagatcgaccggaagaagtctggagga
aaacccaagatcgccaagaaggccaggatcgcacagaaagctcagcagaggaagacgaat
atctccagatatctgccgatccaggctcaccgctccatagaaagtcagctacaggttctt
cctggtccagaagtcacctacagcgatttcctggatgccatcgaccgtagagaggatacc
ttctacgtagtttctttcagacgggaccacctgctgcttcctgccatcagccacaacaaa
accagccggcccaaaatgtctctggtgatgccggccatgtcggtgaatgagagcctctat
aactcctcccagggctatgagatgatgatgcaggtggactgtgaggtcatggacactcgg
attgtccccatcaagtcgtccgccgtccccccgtcccttcgagacccgcctccccgtcct
cccagcccccaccatcaccacggcaaccacacctccctccgaggacgccaccactcctcc
tcttcctccccgtcgtcgtctccaaggcagcgtttacccacccgccgacggacaggcgaa
tatttaatcagccaatcagaaggagtctga

DBGET integrated database retrieval system