KEGG   Amphiprion ocellaris (clown anemonefish): 111569607
Entry
111569607         CDS       T06018                                 

Gene name
pdgfra
Definition
(RefSeq) platelet-derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
aoce  Amphiprion ocellaris (clown anemonefish)
Pathway
aoce04010  MAPK signaling pathway
aoce04020  Calcium signaling pathway
aoce04144  Endocytosis
aoce04510  Focal adhesion
aoce04540  Gap junction
aoce04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:aoce00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111569607 (pdgfra)
   04020 Calcium signaling pathway
    111569607 (pdgfra)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    111569607 (pdgfra)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111569607 (pdgfra)
   04540 Gap junction
    111569607 (pdgfra)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111569607 (pdgfra)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aoce01001]
    111569607 (pdgfra)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:aoce04090]
    111569607 (pdgfra)
Enzymes [BR:aoce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     111569607 (pdgfra)
Protein kinases [BR:aoce01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   111569607 (pdgfra)
CD molecules [BR:aoce04090]
 Proteins
  111569607 (pdgfra)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 V-set Herpes_gE Receptor_2B4 C2-set_2
Other DBs
NCBI-GeneID: 111569607
NCBI-ProteinID: XP_023127602
Ensembl: ENSAOCG00000005156
LinkDB
Position
Unknown
AA seq 1471 aa
MDGVRTYVFFGGILVVLVSVTCGLSPPTIVSNQEEFVLQPNSLFNISCTGKRNVVWAEPL
PQNTHVYPGYYTATLFIDNATVENTGYYMCTYQTQEGDANGEPEEFNEAGIYVFVPDPHA
PFVPETQDNLVVSMEPSGVAISCRVSHPDSHVILRSVPSGEEMPAFYDNKMGFFGSLSPG
QYQCETTLNDQIFTSDIYTVKLEAPEEVEDFDVEVKASDETVTVGQPFLITCIGPSGQGF
DQQWLHPKKQATEAFQTKQALPDQVIYTLSITQATSQDSGTYECSITNKISGVVRVSSVS
VTVFEENSFVTLDHSGILATEFVSILEETEYTILIDAYPAPKVTWHKDGKALPGNYYIVI
KTAHLEGNRYQSVLTLRQPLEKDNGNYSITASSGSHTAQFSFILKVKATTAALIPPSSAP
VLLPEKEEMVIPLHTPFTLTCRGEAKLAWEMPLDVPEQTQEDNSGLFVTTITVDSATAMH
TGYYTCFYSRNATDDAEDSSIYIYVPDPDVPFVPSPVPFGNHVLSDHEEMEIQCRVSDPS
ANVTLINVDTQKPVPSVYDSKRGALGVFTAGTYVCKALINGEEHYSGEYIVHGWTGGAAL
HVELTAKRTALLVGETITVTCLARGSEILEDHWKYPGKLANRAIKAVHENKRDQEILYIL
TIPQASTKDSGIYSCSITDIISNESQTKQLAVRVFASEFMSIQPEFREYESADLDEVREF
RAQINSFPSARVTWLKDGIPLSDVTAEISTSLRQISETSYMSVLTLIRAKEEDSGNYTIR
VENGNQSRDVSLMLEVKVPAVIVDLMDIHHGSATGQSVVCITRGQPTPVVEWFVCKNIKH
CANDSSAWVPLPANSTDITMDSHIDEDSNLESQVMFGHLESTLAVRCLARNEMAAVSREV
KLVSNGPHPELTVAAAVLVLLVIVIISLIVLVVIWKQKPRYEIRWRVIESVSPDGHEYIY
VDPMQLPYDSRWEFPRDRLVLGRILGSGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTAR
SSEKQALMSELKIMTHLGPHLNIVNLLGACTKAGPIYIITEYCFYGDLVNYLHKNRENFL
SLNPEKNKKELDIFGINPADESSRSYVILSFESKGDYMDMKQADNTQYVPMLEMSNASKY
TDIQRSNYDHPPSQKSSSECEMDNLLSDDMNEGLTTTDLLSFTYQVAKGMEFLASKNCVH
RDLAARNVLLSQGKIVKICDFGLARDIMHDNNYVSKGSTFLPVKWMAPESIFDNLYTTLS
DVWSYGILLWEIFSLGGTPYPGMVVDSSFYNKIKSGYRMSKPEHAPHDVYEMMMKCWNSE
PEKRPSFLGLSENVASLLPSSYKRHYEKVNHEFLKSDHPAVTRVCVENDEDYIGITYKNQ
GKLKDRESGFDEQRLSSDSGYIIPLPDLDPISDEEYGKRNRHSSQTSEESAIETGSSSST
FAKREGETLEDITLLDEMCLDCSDLVEDSFL
NT seq 4416 nt   +upstreamnt  +downstreamnt
atggatggagtgaggacgtatgtcttctttgggggaatattggtggtgctggtttcagtt
acctgtggactgtcgccgccgaccatcgtgtccaaccaggaagagttcgtcctgcagcca
aactccctcttcaacataagctgcaccgggaaaagaaacgtggtttgggctgagcctctg
ccccaaaacacccacgtttatccaggatactacaccgcgacgctcttcattgacaacgca
accgtggaaaacaccggctactacatgtgcacctaccagacccaggaaggagacgcgaac
ggcgaaccggaggagtttaatgaggcgggaatttatgtcttcgtcccagatccccatgcg
ccatttgtacctgagacacaagataacctggttgtgtccatggaaccgtctggagttgcc
atctcatgccgtgtatctcatcccgactctcacgtcatcttgaggagtgtccccagtgga
gaggagatgcctgccttctacgacaacaagatgggcttctttggaagcctctctcctggg
cagtaccagtgtgaaaccactctgaacgatcagatattcacaagtgacatttacactgtg
aaacttgaagcccctgaggaagtggaggactttgacgtggaagtgaaagctagtgatgag
acagtgacggtagggcagccgttcctcatcacctgcatcggtccctctggccagggcttc
gaccagcagtggcttcatccgaaaaaacaggctacagaagcatttcagacgaaacaggct
ttacctgaccaggtcatctacaccctcagtatcacacaagccacttctcaggacagcggc
acctatgaatgctccatcaccaacaaaatcagtggagtggtcagagtcagcagtgtgtct
gtgaccgtttttgaggagaattcttttgtgactttggaccacagtgggattctagcaacg
gagtttgtcagcattttagaggagacagagtatactatcctcattgatgcatacccggcc
cccaaagtgacgtggcataaggacggcaaagccttaccagggaattactacattgtcatc
aaaacagcccatcttgaagggaatcggtatcagagcgttctgacattacgacagcctctg
gagaaagacaatggaaattacagcatcactgccagtagtggctctcacactgctcagttc
tcctttatcctcaaagtgaaagccaccaccgcagcgttgatcccaccatcctccgctcct
gtgctgctgccagagaaagaggagatggtgattcccctccacactccttttacattgaca
tgtcgcggagaggcaaaactggcctgggaaatgcccctggatgtgcccgagcaaacgcag
gaggacaacagtggtttgtttgtcaccaccatcactgtggacagcgccacagcgatgcac
actggctactacacatgtttttacagtagaaatgctactgacgatgcagaggacagcagc
atctacatctatgtgccagatcctgatgttccctttgtgccgtcaccggtgccttttgga
aaccatgtcctgtccgaccacgaggagatggagatccagtgtcgggtgtctgatccgagt
gctaacgtgaccctgattaatgttgacacccagaagcctgtgcctagtgtttatgacagt
aaaaggggtgctttgggggtattcactgctggaacctatgtttgtaaggccctcataaat
ggagaggaacactacagcggagaatacattgtccacggctggacaggaggcgctgcgctg
catgttgagctgacagccaaaaggacggctctgctagtaggagagacaatcactgtcacc
tgtctggctcgaggatctgagattctagaagaccactggaaataccctgggaaactggct
aatcgtgcaatcaaagcagtgcatgagaataagagggatcaggagattctttacatcctg
acaatcccacaagcctcaaccaaagacagcggcatctactcatgctccatcactgatatt
atcagtaatgagagccaaacgaaacaactagctgttcgagtttttgcaagtgagtttatg
tccatccagccggagttccgagaatatgaatctgctgacctggatgaagtccgggagttc
agggctcagatcaactccttccccagtgctcgtgtcacttggctcaaagacggcatccca
ctcagcgatgtgacagccgagatctccaccagcctccggcagatcagtgagaccagctac
atgagtgttctcaccctgatccgggccaaggaggaggacagtgggaactacaccatccgg
gtagagaatggaaaccaaagtcgtgatgtcagcttaatgctggaggtcaaagtgcctgca
gtcattgtggacctgatggacatccaccatggttcagccacaggccagtctgtggtgtgc
attactagagggcagcccactcctgtggttgagtggttcgtctgcaagaacatcaaacat
tgtgccaatgactcatctgcttgggttcccctccctgccaactccactgacattacaatg
gactcacacattgatgaagacagtaacctggagagccaggtcatgtttggtcatctggaa
agcacactagcagtgcgctgcctggccaggaacgaaatggccgctgtcagcagggaggtc
aaactggtttccaatggccctcatcctgagctgactgtagctgctgctgtgctggtgctc
ctggtcattgtcatcatctcactcattgtcttggttgttatctggaaacagaagccacga
tatgagatccgctggagggtcatagagtccgtgagcccagatggccatgagtacatctat
gtggatcccatgcagcttccctatgactctcgatgggagtttccccgtgacagacttgtg
ctcggtcgtatcctgggctctggagcctttgggaaggtggtagaaggcaccgcctatgga
ctcagccgctctcaacctgtcatgaaggtggcagtgaaaatgctgaaacccacagcacgc
tccagtgagaaacaggccctgatgtctgaactgaagatcatgactcatcttggacctcat
ctcaacattgtcaaccttctgggagcatgcaccaaagcaggccctatctacattatcact
gagtactgcttctatggggacctggtgaactatctgcacaagaacagggagaacttcctc
agcctgaacccagagaaaaacaaaaaagagttggacatctttggaatcaaccctgccgat
gagagcagcagaagctatgtgatcctgtcctttgagagtaaaggcgactacatggatatg
aagcaggctgacaacactcagtatgtgcccatgctggagatgagcaacgcctccaagtac
acagacatccagaggtctaactacgaccacccaccatcgcagaaaagctcgagtgagtgc
gagatggacaacctgctgtctgacgacatgaatgaaggcctcaccaccaccgacctgctc
agcttcacctaccaggtggccaaaggcatggagttcctggcttccaaaaattgtgtgcat
cgggatctcgcagccaggaatgtcctcctctctcagggcaagatagtgaagatctgtgac
tttggactggccagggacatcatgcatgacaacaactatgtctccaaagggagcactttc
ctgccagtgaagtggatggcaccagaaagtatttttgacaacctgtacaccactctcagt
gatgtttggtcctatggcatccttctctgggagatattctccttaggtggcaccccatac
ccaggaatggtggtagactcgagcttctacaacaagatcaagagtggatacaggatgtca
aaaccagagcatgcaccacatgatgtgtatgagatgatgatgaagtgctggaacagtgaa
ccagagaagaggccttctttcctgggtctgagtgaaaatgtggcttctttgctgccctcc
agctacaagaggcattatgagaaggtgaaccatgagttcctcaagagtgaccatcctgct
gttactcgtgtgtgcgtggaaaatgacgaggactacattggcatcacgtacaagaaccag
ggtaagctgaaggacagggaaagcggcttcgatgagcagcggctgagttccgacagcggc
tacatcattcctctgcctgacttggacccaatatctgatgaagaatacggaaagaggaac
agacacagttctcaaacgtccgaggagagcgccatcgagacgggctccagcagctctacc
ttcgctaagcgtgagggtgagactctggaggacatcacactgctggacgagatgtgtctg
gactgtagtgacctggtggaggacagctttctgtga

DBGET integrated database retrieval system