KEGG   Amphiprion ocellaris (clown anemonefish): 111571117Help
Entry
111571117         CDS       T06018                                 

Definition
(RefSeq) procollagen galactosyltransferase 2-like
  KO
K11703  collagen beta-1,O-galactosyltransferase [EC:2.4.1.50]
Organism
aoce  Amphiprion ocellaris (clown anemonefish)
Pathway
aoce00310  Lysine degradation
aoce00514  Other types of O-glycan biosynthesis
aoce01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aoce00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    111571117
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    111571117
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:aoce01003]
    111571117
Enzymes [BR:aoce01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.50  procollagen galactosyltransferase
     111571117
Glycosyltransferases [BR:aoce01003]
 O-Glycan biosynthesis
  O-linked Gal type
   111571117
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_25 Glyco_tranf_2_4 Anp1
Motif
Other DBs
NCBI-GeneID: 111571117
NCBI-ProteinID: XP_023129965
Ensembl: ENSAOCG00000002823
LinkDB All DBs
Position
Unknown
AA seq 615 aa AA seqDB search
MRGVVAAGVAVLWALLAALVPGGASELATVVQEQVKPESTLLKPKVMIAIVARNAAHSLP
HYLGCIERLDYPKERIAIWAATDHNVDNTTAMLREWLKRAQRLYHYVEWRPMEEPRSYTD
EWGPKHWPPSRFNHVMKLRQAALKAARERWADYILFVDSDNLLTNPQVLNLLMAENLTLV
APMLESRSLYSNFWCGITPQGYYKRTPDYQPIREWKRLGCFPVPMVHSTFLVDLRRESSR
DLTFYPPHSDYSWAFDDIMVFAFSARQAGVQMYVCNREHYGFLPVPLKAQQNVEDERESF
IHTITEALIDHDIEPSEHVYAPPSLQGKIGFDEVFLINLKRRLDRRTRMLKTMVSLGLQA
TLTDAVDGKALNTSQLQALGIEMMPGYKDPYSGRVLTRGEIGCFLSHHSIWMQVIERGLQ
KVLVLEDDVRFEPRFKRRLQAIMDDIDKTQLDWDLIYVGRKRMQVQQPEQSVDGVHNLVV
ADYSYWTLGYALSQQGARKLLAAQPFLKMLPVDEFLPIMFNKHPNVQYMSQFEPRDLKAF
SVEPLLIYPTHYTGEPGYISDTETSTIWDDEAVATDWDRQHDRKTAQQGRIRPVAQNSVT
GDSPPPAARASRDEL
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atgcggggggtcgtggccgcgggagtcgccgtgctgtgggcgctgctggccgctctggtg
cccggcggcgcgtcggagctggcgacggtggtgcaggagcaggtcaagcccgagtccacg
ctgctgaagccgaaggttatgatcgccatcgtggctcggaacgctgcgcacagcctgccg
cactacctgggctgcatcgagaggctggactacccgaaggagcgcatagcgatctgggca
gcaacagaccataatgtggacaacaccacggccatgttgagagaatggctgaagagagcc
cagcgtctgtatcactacgtggagtggaggccgatggaggagcccaggtcttacacagat
gagtggggtccaaaacactggcctccgtccagattcaaccacgtgatgaagctgagacaa
gcggcactgaaggctgcacgagagcgatgggctgactacatactgtttgtagatagcgac
aacctgctgaccaaccctcaagttctgaacctgctgatggctgagaacctgacgttagtg
gcgcccatgttggagtctcgctcgctctactccaacttctggtgtggcatcacccctcag
ggttactacaagcgaacgccagactaccagccaatcagagagtggaagcggctcggttgc
ttccccgttcccatggtgcacagtactttcctggtggacctgcgccgtgaatccagcaga
gatctgaccttctaccctcctcactctgactacagctgggcgttcgatgacatcatggtg
tttgctttctcagcacgtcaagcaggtgtgcagatgtatgtgtgcaacagagagcactat
ggtttcctgccagtccctctcaaagctcagcagaatgtagaggacgaaagggaaagtttc
atacacaccatcaccgaggctttgattgaccacgacatcgagccctccgagcacgtttac
gctccgccatcgctgcagggcaagatcggcttcgatgaagttttcctgattaacctgaaa
cggcggctggacagaagaacccggatgttgaaaacaatggtctctctgggccttcaggcc
acgctgacagacgcagtggacggcaaggctctgaatacgtcacagctgcaggcgttggga
atagaaatgatgccgggctacaaggacccatattctggccgagttctgaccagaggggag
atcggctgcttcctgagccaccactctatatggatgcaggtgatagaacgtggtctccag
aaggttcttgttttagaggacgatgtgaggtttgagcccaggtttaaacgaaggctgcag
gccataatggacgacatagacaaaacccagctggactgggacctcatctacgtggggcgt
aagcgtatgcaggtgcagcagccggagcagtcggtggacggtgttcacaatctggtggtg
gcagattattcctactggacgctcggctacgcactttcccagcaaggagccagaaagctg
ctggctgcacagcctttcttgaagatgctgcctgtggatgagttcctgcccatcatgttt
aacaaacaccccaatgtccagtacatgtctcagtttgagcctcgggacctgaaggccttc
tccgtggagccgctgctcatctatcccacccactacaccggagaaccgggctacatcagc
gacaccgagacctccaccatttgggacgacgaagccgtggccaccgactgggaccggcag
cacgaccgcaagacggcccagcagggtcgcatccggcccgtggcccagaacagcgtcacc
ggagactcgccgcctccagcagctcgagcatcacgagacgaactctga

DBGET integrated database retrieval system