KEGG   Amphiprion ocellaris (clown anemonefish): 111571438
Entry
111571438         CDS       T06018                                 

Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1C-like isoform X1
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
aoce  Amphiprion ocellaris (clown anemonefish)
Pathway
aoce04010  MAPK signaling pathway
aoce04020  Calcium signaling pathway
aoce04260  Cardiac muscle contraction
aoce04261  Adrenergic signaling in cardiomyocytes
aoce04270  Vascular smooth muscle contraction
aoce04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:aoce00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111571438
   04020 Calcium signaling pathway
    111571438
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    111571438
  09153 Circulatory system
   04260 Cardiac muscle contraction
    111571438
   04261 Adrenergic signaling in cardiomyocytes
    111571438
   04270 Vascular smooth muscle contraction
    111571438
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:aoce04040]
    111571438
Ion channels [BR:aoce04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   111571438
SSDB
Motif
Pfam: Ion_trans CAC1F_C GPHH Ca_chan_IQ PKD_channel
Other DBs
NCBI-GeneID: 111571438
NCBI-ProteinID: XP_023130342
LinkDB
Position
Unknown
AA seq 2319 aa
MLRSLFQRKPKHERLEEEPEVRFKGSLVSETDLGYTYVRPGGSDYSPPPPPPLPRAPVPA
LTNEHSGSGSHGDHGGGGGGVNHGVVGLAPEHIPTPGAALSWQAAIDAARQAKMMGNAAS
GGGAGLGSGGGGPISTASSTQRKRQHYSSKPKKQTTTTATRPPRALLCLTLKNPIRRACI
SIVEWKPFEIIILMTIFANCVALAVYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKV
IAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKGDGAAPIGGKAAGFDVKALRA
FRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKSC
FDNHTGAIAEKKAPCAPDNAYGRHCTENGTQCRGGWEGPNDGITNFDNFAFAMLTVFQCI
TMEGWTDVLYWVNDAVGYRWPWVYFVTLIIIGSFFVLNLVLGVLSGEFSKEREKAKARGD
FQKLREKQQLEEDLKGYLDWITQAEDIDPENEEEGMDDDKPRNLSMPASENESVNTDNAH
GGDVEGETCCTRLAIRISKSKFSRYSRRWNRLCRRKCRAAVKSQVFYWLVIFLVFLNTLT
IASEHHKQPQWLTDVQDIANKVLLALFTGEMLLKMYSLGLQAYFVSLFNRFDSFVVCGGI
LETILVETKIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFL
FIIIFSLLGMQLFGGKFNFDETRRSTFDNFPQSLLTVFQILTGEDWNSVMYDGIMAYGGP
SFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQKEEEEEKERKKLARLA
SPEKRHDNEKPPLEEEKKEKIELKSITSDGETNTATKINMDDCCGDESEEKNPYPANDYI
GDDDDDEPEMPVGPRPRPLSDIQLKEKAVPMPEARAFFIFSHTNKFRVLCHKIVNHNIFT
NLILFFILLSSISLAAEDPVKNDSFRNQILGYADHVFTGLFTIEIILKMTAYGAFLHKGS
FCRNYFNILDLVVVSVSLISSGIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQCVF
VAIRTIGNIVIVTTLLQFMFACIGVQLFKGKFFYCSDTSKHTEADCRGSYIMYKDGDVGK
PEKANREWENSAFNFDDVLQGMMALFAVSTFEGWPGLLYRAIDSHAEDVGPIYNYRVVIS
IFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPLRRYI
PKNPYQYKVWYVVNSTYFEYLMFTLILLNTICLAMQHHGQTKHFNDAMNILNMLFTGLFT
VEMILKLIAFKPRGYFSDPWNVFDFLIVIGSIIDVILSEINPADSSSSSSSSSSSSSSSS
SSHPPVVRPMGLQNSEENARISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPY
VALLIVMLFFIYAVIGMQMFGKIALQDHTQINRNNNFQTFPQAVLLLFRCATGEAWQEIM
LACSPKRACEKGSTNENSTDTEDCGSQFAIIYFVSFYMLCAFLIINLFVAVIMDNFDYLT
RDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRL
VSMNMPLNSDGTVMFNATLFALVRTALRIKTEGNLEQANEELRAIVKKIWKRTSMKLLDQ
VVPPAGDDEVTVGKFYATFLIQEYFRKFKKRKEQGLVAKVPPKTALSLQAGLRTLHDIGP
EIRRAISGDLTVEEELDKGLKEPVSAASEDDIFRVKRTGGLFGNHVNYYNQSDGRGSFPQ
SFTTQRPLHISQKGSPCEGESPSHEKLMDSTTFTPSSYSSSGSNANINNANNTGMAGVAT
QGISRFPSPSISTVDGHTGQPLTPILLPRSAWCFPPKRTCFYDTLMRSDSSDSRLPIIRR
GEGSTEETYDESYADDREYHEDDHSLSSDMLVYHDETCKQLTPMEDAEEVEDRRGGGGWQ
SPRRVFLCPTSLGRRSSFHLECLRRQSRPDVSQKTAVPLHLVHHQALAVAGLSPLLRRSH
SPTLFSRLCSTPPASPTGQCSDSSYQRVPSLRLEGSSSHEKLNTSLPSVNCGPWYSDSNG
NSRVPSPSPSMSASSQRAPRPVSLTVPSLLGKDSSSLSHGSAGSLVEAVLISEGLGHFAQ
DPSFIEATKAELADACDMTIEEMEHAANNILNGNSTTNATSSTSSTSQHNPNGNLLPFHT
AAAAAAATTTATPHRDRVPSLSPSEGGGESGGSRGSIHGPSSIEERQELLARGRAQEEEE
EEPAGREEGHHRGSVVIGGARQRNSGLLEDEDMECVTSL
NT seq 6960 nt   +upstreamnt  +downstreamnt
atgctgagaagcctgtttcagaggaagcctaaacatgagaggctggaggaggaaccagaa
gtcagatttaaaggctctctggtgtcagagacagacctgggatatacatatgtccgacct
ggaggctccgactactctcccccaccgcctccccctcttcctcgtgctcccgtccctgcc
ctgaccaacgagcacagtggcagcggtagccatggtgaccatggcggaggagggggcggg
gtcaaccacggcgtggttggcctggctccggagcacatccccacgccaggggcagccctg
agctggcaggcggccatcgacgctgcgagacaggcgaagatgatgggcaatgctgcatcg
ggcggaggggcggggcttgggtcaggagggggcgggcccatctctacggccagttccacg
caaaggaagagacagcactacagctctaaacccaagaaacagaccacaacgacagccaca
aggccgccacgggccctgctctgtctcacactcaagaaccccatccgcagggcctgcatc
agcatcgtcgagtggaaaccatttgagatcatcatcctgatgaccattttcgccaactgt
gtggccttagctgtctacatccccttccctgaggatgactcgaatgccaccaactccaac
ttggaacgtgtggagtatctgttcctcatcattttcacggtggaggcgttcctgaaggta
atagcctacggcctgctcttccaccccaacgcctacctgaggaacggctggaatctgctc
gacttcatcatcgtagttgtagggttgttcagtgcgatcttggaacaggccacaaagggg
gacggggcagctcctattggagggaaggcagcgggcttcgatgtcaaggctctgagggca
ttcagagtactcagaccactcagactggtctctggagtaccgagtttacaggtagtgttg
aactccataatcaaagccatggttcctctgctccacattgccctactggtcctcttcgtc
atcatcatctatgccatcatcggtctggagctcttcatgggcaagatgcacaagagctgc
tttgacaaccatacaggcgccattgcagaaaagaaggcaccgtgcgcacctgataacgct
tacggtcgacactgtacagaaaatggaacacagtgtagaggtggctgggagggcccaaac
gacggcatcaccaacttcgacaacttcgcctttgccatgttgacagtgttccagtgtata
accatggagggctggacggacgtactgtactgggtgaatgatgctgtaggttacaggtgg
ccctgggtgtattttgtcaccttaatcatcatcggatccttctttgtgctaaacttggtt
ctgggggtgttgagcggagagttttccaaggagagagagaaggccaaggcacgtggtgac
ttccagaaactcagagaaaaacagcagctggaggaagacctcaagggctatttagactgg
atcactcaggctgaagatattgacccagagaatgaagaggagggcatggacgatgacaaa
cccagaaacttgagcatgccagccagcgagaatgaatcagtcaacacggacaacgcccac
gggggagacgtggagggggagacctgctgtacccggctagcaattaggatctccaaatcc
aagttcagtcgctactctcggaggtggaacaggctgtgtaggaggaagtgccgggcggca
gtcaaatcacaggttttttattggctggtcatcttcctggttttcctcaacactctgacc
atcgcctctgagcatcacaagcagcctcagtggctaaccgacgtacaagacatagccaat
aaggttctgcttgcactcttcactggtgagatgctgctgaagatgtacagtctgggccta
caggcgtactttgtgtcactcttcaatcggttcgacagcttcgtagtatgtggagggatt
cttgagaccattctggtggaaacaaagatcatgtctcctcttggcatctctgtgctacgt
tgcgtacgcttgctcagaatcttcaaaataaccaggtactggaactccctgtccaacctg
gtggcctccctgctaaactctgtccgctccattgcttccctcttgctcctgctcttcctc
ttcatcatcatcttctccctgctgggcatgcagctcttcggggggaaattcaacttcgac
gagactcgacgcagcaccttcgacaactttccccagtctctgctcaccgtgtttcagatc
ctaacaggagaagactggaactcagtgatgtatgatggtatcatggcctacggtggtcca
tcttttcctggcatgctggtctgcatctacttcatcatcctcttcatctgtggaaactat
atcctcctgaatgtcttcttggccatcgctgtcgacaatctggcagatgctgagagcctg
acatcagcccagaaagaagaggaggaggagaaggagaggaaaaaactggccaggctcgcc
agtccagagaagcgtcatgacaacgagaagccgcctctggaggaagagaagaaggagaag
atcgagctgaagtctattacttctgatggagagaccaacaccgctacaaagatcaacatg
gatgactgctgtggagatgaaagtgaggagaagaacccatatcctgcaaatgattacata
ggagacgatgatgacgacgagccagagatgccagttggcccgaggccgcggccactctct
gacatccagctgaaggagaaggccgttcctatgcctgaggcccgcgctttcttcatcttc
agccacaccaacaaattcagggttctgtgccataagatcgtcaaccacaacatcttcacc
aacctcatcctcttcttcatcctgctcagcagcattagtctggcagcagaggacccagtc
aagaatgactccttcagaaaccagatccttggctatgcagatcacgtcttcactggactc
ttcacgatagagatcattcttaagatgacagcgtatggagccttcctccataaaggttcc
ttttgtaggaactatttcaacatcctggacttagtggtggtcagcgtgtccctcatctcc
tctggaatacagtccagtgcaattaatgtggtgaagatcctgcgagttctgcgagtgctg
agaccactgagagccatcaacagagccaaaggactgaagcatgttgtgcagtgcgtgttt
gtggccatcaggaccatcggcaacatcgtcatcgtcaccacgttgctgcagttcatgttc
gcttgtattggagtacaactctttaagggcaagttcttctactgctccgacacctctaaa
catactgaggcagactgcaggggttcttacatcatgtataaggacggtgacgtggggaag
cctgaaaaagccaacagagagtgggagaacagtgcatttaactttgacgatgtcctgcaa
ggcatgatggctctgtttgctgtgtctacctttgagggttggccagggttactgtaccgg
gccatagactctcatgctgaggacgtcggtcccatctacaactaccgcgtggtcatctcc
atcttcttcatcatctacatcatcatcatcgccttcttcatgatgaacatcttcgtcggt
ttcgtcattgtcacattccaggagcaaggagagcaagagtataagaactgcgagctggac
aagaaccagcgtcagtgtgtggagtatgccctgaaggctcgtccattgcgtcgctacatc
cccaagaacccataccagtacaaggtgtggtatgtggtcaactccacctactttgagtac
ctgatgttcacactcatcctcctcaacaccatctgtctggccatgcagcatcatggacag
accaaacatttcaatgatgctatgaacatcctcaacatgctcttcactggactgttcact
gttgagatgatcctgaaactgatcgccttcaaacccagggggtactttagtgatccctgg
aatgtgtttgatttcctcatcgtaattggcagcataatagacgtcattctcagtgaaatc
aacccagctgactcgtcctcgtcctcctcctcctcttcgtcctcctcttcctcctcttcc
tcctctcacccccctgtggtaaggccaatgggactgcagaactctgaagagaacgccagg
atctccatcaccttcttccggctgttccgcgtgatgaggctggtgaagctgctgtctcgc
ggggaagggattcggaccctgctgtggaccttcatcaaatccttccaagctctgccctac
gtagctctgcttatagtgatgctgttcttcatatacgctgtcatcggcatgcagatgttt
ggtaagatagcgctgcaggaccacacgcagatcaacaggaacaacaatttccagacattc
cctcaggcagtgctgctgctcttcagatgtgcgacaggtgaggcgtggcaggagatcatg
ctggcgtgttcgcccaaacgagcgtgtgagaaaggatcgaccaatgaaaacagcacagac
accgaggactgtggcagccagtttgctatcatttactttgtcagcttctacatgctctgt
gccttcctgatcatcaacctgtttgtggccgtcataatggacaactttgactacctgacg
cgtgattggtcgatcctggggccgcatcatcttgacgagttcaagaggatctgggctgaa
tatgacccagaagctaaagggaggataaagcacctcgatgtggtgactctgctccggaga
atccagcctcccctcggcttcggaaagctctgtccacacagggtggcttgcaagcgtctg
gtgtcgatgaacatgcctctgaacagcgatggaacagtgatgtttaacgccacactgttt
gctctggtcagaaccgcactcaggattaagactgaaggcaacctggagcaggctaatgag
gaactgagggcaatagtgaagaagatctggaagagaaccagcatgaagctactggatcaa
gtggtgcctcctgctggtgatgatgaggtaacagttgggaagttctacgccaccttcctc
atccaggaatatttccgcaagtttaagaagaggaaagaacaagggctcgtggccaaggtg
ccccccaaaactgccctctctctgcaggcgggcctgcggacattgcatgacattggtcca
gagattaggagggccatctctggagacctgaccgtggaggaggagctggataaaggcctg
aaggagcctgtgtcagcagcatctgaggatgatatcttcagggtaaagcgtacaggcggg
ttgtttggcaaccacgtcaactactacaaccagagcgacggccgtggctccttcccacag
tcctttactacccagcgtcccctgcatatcagccagaaaggctcaccttgtgagggcgag
agtccgtctcatgagaagctcatggactcgacgactttcaccccttcctcttactcctca
tcaggctccaacgccaacatcaacaatgccaacaacactggcatggccggggtggcaacg
cagggcatcagtcgattcccaagcccatccataagcactgtggacggacacacggggcag
ccgctcacccccatcctgctgccaagatctgcatggtgctttcctccaaagaggacgtgt
ttttatgacaccctaatgcgctcggactcgagtgacagccgtctgccaatcatccgaaga
ggggaggggtcgacggaggagacgtacgatgagagctatgcagacgacagggagtaccac
gaggatgaccactcgctctcctctgacatgctggtgtatcatgacgaaacatgtaagcag
ctgactcccatggaggatgcagaggaggtagaggacagaagaggaggaggagggtggcag
tctcccaggagagtcttcctctgccccacttctctggggcggagatcgtccttccatctg
gagtgtctccggagacagtccaggccagatgtctcccagaagacagcagtacctttacat
cttgtacatcatcaggctctggcagtggcagggttgagtcctctgctaagaaggagtcac
tcaccgaccctcttcagtcggctgtgctccacgcctccagccagtcccacaggccaatgc
agcgattcctcttatcagcgagttccctccctgaggttagagggctccagttcccatgaa
aagctcaatactagcttgccttctgtcaactgtgggccctggtacagcgacagcaatggg
aacagccgggtgcccagtcctagccctagcatgtcagcgtccagtcaaagagcaccacgg
ccggtgtcgctcacggtgccctcgctactgggaaaagactccagctcgctgtctcatggc
agcgcaggaagtctggtggaggcggtgctaatatcggagggtttgggtcattttgcccag
gacccatcgttcatcgaggcgaccaaagccgagttggcggatgcctgcgacatgaccatc
gaggagatggagcacgccgccaacaacatcctcaatggcaacagtaccacaaacgccacg
tccagcacctcctccacctctcagcacaacccgaacggcaacctcctccccttccacaca
gcagcagcagcagcagcagcaacaacaacagcaacaccacacagggaccgagtgcccagc
ttgagtcccagcgaaggtggaggagagtctggaggaagccggggctccatccacgggccg
tcctctatagaggagcggcaggagctgctggccagggggagggcacaggaggaggaggag
gaggagccagcagggagggaagaggggcaccacagaggctcagtggtgattggaggagcg
cggcagaggaacagcgggctgttggaggacgaggatatggagtgtgtgacgagtttgtag

DBGET integrated database retrieval system