KEGG   Amphiprion ocellaris (clown anemonefish): 111571580
Entry
111571580         CDS       T06018                                 

Gene name
epo
Definition
(RefSeq) erythropoietin isoform X1
  KO
K05437  erythropoietin
Organism
aoce  Amphiprion ocellaris (clown anemonefish)
Pathway
aoce04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:aoce00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111571580 (epo)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:aoce04052]
    111571580 (epo)
Cytokines and growth factors [BR:aoce04052]
 Cytokines
  CSF and other factors
   111571580 (epo)
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 111571580
NCBI-ProteinID: XP_023130586
Ensembl: ENSAOCG00000021236
LinkDB
Position
Unknown
AA seq 186 aa
MLQKTGRAGLLALLLIVLEWTRPGLPSPLRPICDLRVLNHFIKEARDAEVAMKSCREGCS
LSESVTVPQTTVDLDVWEKKNALEQAQEVQTGLWLLQQALSLLRTSVSNTELHSHIDTSI
RNLLSINAVLRSLNIQEYTPPASAVGLEGTWRASSATDLLQVHVNFLRGKVHLLLSNAQA
CQQDVS
NT seq 561 nt   +upstreamnt  +downstreamnt
atgttgcagaaaacgggtagagcaggactgcttgccttgctgttaatagtactggagtgg
accaggccaggcttgccgtcccccctgaggccgatctgcgacctgagggtcctgaaccat
ttcataaaggaagctcgagacgcagaagtcgctatgaagtcatgtagagaaggatgcagc
ctgtcagagtctgtcactgttccccaaaccacagtcgacttggatgtctgggagaagaaa
aatgcgctggagcaagcccaggaggtgcagaccggcttatggcttttacaacaggctctc
agcttgctgcggacgtcagtcagcaacacagaactgcacagccacatagacaccagcatc
agaaacctgctcagcatcaacgctgtgctgcgtagcctcaacatccaggaatatactcca
ccagcaagtgcagtggggctggagggaacatggagggcgtcctcagcaacagatctgctc
caagtccatgtcaatttcctccgaggtaaagtgcacctcctcctttccaatgcacaggct
tgccagcaagatgtcagctga

DBGET integrated database retrieval system