KEGG   Amphiprion ocellaris (clown anemonefish): 111573186
Entry
111573186         CDS       T06018                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B-like
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
aoce  Amphiprion ocellaris (clown anemonefish)
Pathway
aoce04012  ErbB signaling pathway
aoce04068  FoxO signaling pathway
aoce04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:aoce00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    111573186
   04068 FoxO signaling pathway
    111573186
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111573186
SSDB
Motif
Pfam: CDI Dsh_C
Other DBs
NCBI-GeneID: 111573186
NCBI-ProteinID: XP_023132987
Ensembl: ENSAOCG00000021829
LinkDB
Position
Unknown
AA seq 191 aa
MCNKMSDVRLSNASPTLERVDARQPDNVRPPVRRNLFGRPDREEVRRYVTDSVREDVQAF
TERYNFDPVTETPLAPRNYDWQQDSDPPEFYLRPPHTVHRPQREIDSPNGDSQDGDGEEE
ASGSRSHRQRDRGDSRKRRSEDSGSCSDECQTKRSHTDEDDDEDQSDGAGTVALTGAQEK
PSRPENCAEVQ
NT seq 576 nt   +upstreamnt  +downstreamnt
atgtgcaacaaaatgtcagatgttcgcctttctaatgcgagcccgacattggagagggtg
gatgcgcggcagccggataatgtcagacctccggtgcgcagaaacctttttggaagacct
gaccgagaggaggtacggaggtacgtgacggactcggtgcgggaagatgtgcaggctttc
acggagagatataacttcgacccggtcaccgagacgccgcttgctccgcgcaattacgac
tggcagcaggacagcgacccaccggaattttatctccgaccgcctcacaccgtccaccgg
ccgcagcgagagatagactcgcccaacggggactcgcaggacggggatggcgaggaggag
gcgagtggaagtcggtcgcatcgccagcgagaccgaggagattcacggaaaagacgctcg
gaagattcaggttcttgctccgacgagtgccagactaaaaggtcgcataccgacgaagat
gatgatgaagaccagtcggacggtgcaggaactgtggcgctaacaggcgcgcaggagaaa
cccagcaggccagaaaactgcgcggaggtccaatga

DBGET integrated database retrieval system