KEGG   Amphiprion ocellaris (clown anemonefish): 111573693
Entry
111573693         CDS       T06018                                 

Definition
(RefSeq) lysophosphatidic acid receptor 2-like
  KO
K04291  lysophosphatidic acid receptor 2
Organism
aoce  Amphiprion ocellaris (clown anemonefish)
Pathway
aoce04080  Neuroactive ligand-receptor interaction
aoce04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:aoce00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    111573693
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111573693
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:aoce04030]
    111573693
G protein-coupled receptors [BR:aoce04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    111573693
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4
Other DBs
NCBI-GeneID: 111573693
NCBI-ProteinID: XP_023133746
Ensembl: ENSAOCG00000004484
LinkDB
Position
Unknown
AA seq 369 aa
MATESSVWNTCNYNHNVTFFYDLVGKNISVGWTPRDSVVIGLGLTLCVIVVLANLMVMVA
ILLNRRFHFPIYYLLGNMAAADLFAGVAYANLMLNTGPWTRMLTKEQWYIRGALIDISLT
ASVANLLAVAVERHQTIITMQLHSNMTKRRVVLLIVCIWVTAIIMGLVPSTFWNCECDLE
DCSTVAPLYSRRFLIFWAVLNLLTFFIMVAVYTRIFIYVRYQSRSMSQHTSEMRHNQTVV
NLMKTISMVLGAFVICWTPGLMTLLLDGLLGKASHANSYEKYCLVIAECNSLVNPIIYSL
RDDEMRRTFKWILCCLCQRGAHQQREPSTVEINSPLPEETLGFVQKSAAQALCKTQDTND
KDGWTDPRV
NT seq 1110 nt   +upstreamnt  +downstreamnt
atggccactgagagcagtgtgtggaatacctgcaactacaaccacaatgtcacctttttc
tacgacttggtgggtaagaatatcagcgtagggtggactccgcgggactctgtggtcatc
ggactgggcttgactctatgtgttattgtagtcctcgccaacctgatggtgatggtagcc
atcctcctgaaccgtcgcttccacttccccatttactaccttctgggcaacatggccgca
gcagacctgtttgccggagtcgcctatgccaacctgatgttgaacacgggcccctggacc
agaatgctcaccaaggagcagtggtacatccgcggggctttgatcgacatcagcctgaca
gcctccgtggccaacctcctagctgtcgccgtggagcgccaccagaccatcatcaccatg
cagctgcacagcaacatgaccaagcggcgtgtggtgctgctgatagtctgcatctgggtc
acagctatcatcatgggcctggtgccatccacgttctggaactgtgagtgtgatcttgag
gactgctccaccgtcgctcccctatacagtcgccgcttccttatcttctgggcagttctc
aacctgctcactttcttcattatggtggcagtgtacacccgtatcttcatctatgtgaga
taccagagccggtctatgtctcagcacacgtcagagatgcgacacaaccagactgttgtc
aacctgatgaaaacaatctccatggttctgggtgcctttgtaatctgctggacgcctggc
ctcatgactctcttactggatgggcttttgggtaaagccagccatgccaacagctatgag
aagtactgcttggtgatagcagagtgcaactctctggtcaatcccatcatctattctctg
cgggacgacgagatgcggaggacattcaagtggatcctttgctgtctgtgtcagagaggc
gctcatcagcagagggagccttcgactgtcgagattaactctccgctgccagaggagact
cttggctttgtccagaagtcagcggctcaggccttatgtaagactcaagacaccaacgac
aaagacggttggacagatcccagggtatga

DBGET integrated database retrieval system