KEGG   Amphiprion ocellaris (clown anemonefish): 111573705Help
Entry
111573705         CDS       T06018                                 

Gene name
adcy5
Definition
(RefSeq) adenylate cyclase type 5 isoform X1
  KO
K08045  adenylate cyclase 5 [EC:4.6.1.1]
Organism
aoce  Amphiprion ocellaris (clown anemonefish)
Pathway
aoce00230  Purine metabolism
aoce01100  Metabolic pathways
aoce04114  Oocyte meiosis
aoce04261  Adrenergic signaling in cardiomyocytes
aoce04270  Vascular smooth muscle contraction
aoce04371  Apelin signaling pathway
aoce04540  Gap junction
aoce04912  GnRH signaling pathway
aoce04914  Progesterone-mediated oocyte maturation
aoce04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:aoce00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    111573705 (adcy5)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    111573705 (adcy5)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    111573705 (adcy5)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    111573705 (adcy5)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    111573705 (adcy5)
   04914 Progesterone-mediated oocyte maturation
    111573705 (adcy5)
   04916 Melanogenesis
    111573705 (adcy5)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    111573705 (adcy5)
   04270 Vascular smooth muscle contraction
    111573705 (adcy5)
Enzymes [BR:aoce01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     111573705 (adcy5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AC_N Guanylate_cyc DUF1053 TBK1_ULD
Motif
Other DBs
NCBI-GeneID: 111573705
NCBI-ProteinID: XP_023133760
Ensembl: ENSAOCG00000003776
LinkDB All DBs
Position
Unknown
AA seq 1199 aa AA seqDB search
MSRSNSVSPPGVGAPGLRGGTEHRSAWGESESVANGCPYSARSPRKKLTRTNSRWREEDD
LEHRPSGRTSTAVSRVSFRSRSAWQDHGEESRDNNRASSKRPDGEVIPKSVELGLEERRA
KPRTDEEEVMPEVNFSLVACCTSVMHIFKSKKFQSEKLERLYQRYFFRLNQSSLTMLMAV
LVLVFTVMLGFHCSGGTAGPSVTFVVVFSVAIFLTLVLMVVCNRNGFHQDHMWVVCYVVI
LVVLVIQVIGVLLVQPRSASEGIWWTVFFIHVIYTLLPVRMRAAVITGVILSAIHVTISG
MLNGMDSFLWKQIVSNVLIFSCTNIVGVCTHYPAEGSQRQAFQETRECIQARLHSQRENQ
QQERLLLSVLPRHVAMEMKADINAKQEDMMFHKIYIQKHDNVSILFADIEGFTSLASQCT
AQELVMTLNELFARFDKLAAENHCLRIKILGDCYYCVSGLPEARADHAHCCVEMGLDMIE
AISLVREVTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANQMEAGGQAGRIHI
TKATLNYLNGDYDVEPGAGGERNAYLKKNSIETYLIVGCSQKRKEEKAMIAKMNRQRTNS
VTHNSGHWTDRPFYNHLGGNQVSKEMKRMGFEDPKDKHFIFRNTQENLNPEDEVDEFLGR
AIDARSIDRLRSEHVKKFLLTFREPDLEKKYSKQVDSRFGAYVACASLVFLFICFIQIVI
VPSSRLMIGFFITCLIILMAVMFVSAVYCCFGIFPVPLQTLSKRIVQSRLNSTLVGVFTI
IVVFLSAFINIFTCSSNDLRSCIKAELNISLDSVNACHAHLLNYSLDAPNSPCGDDALIC
SFPEVQYFSSCVLLSLLACSVFLQVSSIGKLFLMLFIELLYLLIMEVPKVSLFDNQDLLV
MANAINAVEQLNGTSCVVDTKVPLRIMTPVVITVFVLALYLHAQQVESTARLDFLWKLQA
TEEKEEMEELQAYNRRLLHNILPKDVAAHFLQRERRNDELYYQSCECVAVMFASISNFSE
FYVELEANNEGVECLRLLNEIIADFDEIISEDQFRQLEKIKTIGSTYMAASGLNDSTYDK
AGRSHIRALADYAMRLMDQMKYINEHSFNNFKMKIGLNIGPVVAGVIGARKPQYDIWGNT
VNVASRMDSTGVPERIQVTTDLYQVLSSYNYTLEYRGVVTVKGKGEMMTYFLTNGPSSS
NT seq 3600 nt NT seq  +upstreamnt  +downstreamnt
atgtccagatcaaacagtgtcagcccacccggagtcggtgcgcccgggctgaggggaggg
accgaacacagatcagcttggggagagtctgagtctgtggccaacgggtgcccatactcg
gccagatccccgcgcaagaagctcacccggaccaacagccggtggagggaggaggatgat
ctggagcaccggccgagcgggcgaacctccaccgcggtcagcagggtcagcttcaggtcc
aggtcggcttggcaggaccatggcgaggagagccgagacaacaaccgcgcatccagcaag
cgtccagacggcgaggtgatacccaagtccgtggagctgggtctggaagagcgcagagcc
aagccgagaaccgacgaggaggaggtcatgcccgaagtaaacttttctctggtggcctgc
tgcaccagcgtcatgcacattttcaaatccaagaaattccagtcggagaagctggagcga
ctctaccagcgctactttttccgcctcaaccagagcagcttgactatgctcatggcagta
ctcgtgctggtcttcacagtcatgctgggctttcactgctccggtgggactgcggggccg
agcgtcactttcgtggtggtgttttccgtggctatcttccttacgctcgtacttatggtg
gtgtgcaacaggaacggcttccaccaggaccacatgtgggtggtgtgctatgtggtcatc
ctggtggtgctggtgatccaggtgatcggagtactgctcgttcagcccagaagtgcctcg
gaggggatctggtggaccgtgttcttcatccatgtaatctatactttgctgcccgtcagg
atgcgcgccgcagtcatcactggagttatactttccgccatccacgtgaccatttctggg
atgttaaacgggatggacagctttctgtggaaacagatagtgtccaacgtgttgatcttc
tcctgcaccaacattgtgggagtttgcacccattaccctgctgagggctcccagaggcag
gccttccaggagaccagagagtgcatccaggctcgtctgcactcgcagagggaaaaccag
cagcaggagcgtcttctgctctcagtacttccccgccatgttgccatggagatgaaagct
gacataaatgccaagcaggaagacatgatgtttcacaagatctacatccagaagcacgac
aatgtcagcatcctttttgcagacatcgaaggtttcaccagtttggcctcccagtgcaca
gcgcaggagttggtgatgactctcaatgaacttttcgcccggtttgacaagctggcagcg
gagaaccactgtctgcggatcaagatcctgggcgactgctactactgtgtatcagggctg
ccagaggccagagccgaccacgcccactgctgtgtcgagatgggactggacatgatagag
gccatctcgctggtacgggaggtgacgggggtgaatgtgaacatgcgagtgggcatccac
agtggcagagtccattgtggggttctgggactcaggaagtggcagtttgatgtttggtcc
aatgatgtcacactagcaaaccagatggaagctggaggccaagctgggcgtatccacatc
actaaagctactttgaattacctgaacggtgactacgatgtggaaccaggggcaggagga
gaaagaaacgcctacctgaagaagaacagcatagaaacctacctcattgttggctgcagt
cagaaaaggaaagaggaaaaggccatgatcgccaaaatgaaccgacagcggaccaactct
gtcacccacaacagtggccactggaccgaccgtcccttctacaaccatctggggggaaac
caagtctccaaggagatgaagaggatgggctttgaagaccccaaggacaagcatttcatt
ttcagaaacacacaggaaaacctaaacccggaggacgaggtggacgagttcctgggccga
gccatcgacgcccggagcatcgaccggctgcgatcggagcacgtcaagaagttcctgctc
accttcagagagcctgacctggagaagaagtattctaaacaggtggactccaggtttgga
gcttatgtcgcctgcgcctccctcgtctttctcttcatctgcttcatccagatcgtcatc
gtgccatcctccaggctgatgatcggcttcttcatcacctgcctcattatcctgatggcc
gtcatgttcgtctcagctgtttactgctgtttcgggatcttcccggttcctctgcagact
ctttcaaagaggatcgtccagtctagactcaacagcactttggtcggcgtcttcactatc
attgtcgtctttctttctgctttcatcaatattttcacctgcagcagcaacgaccttcgg
agctgcatcaaagcggagctgaacatcagcctggacagtgtgaacgcctgccacgctcac
ctcctcaactacagcctggacgctccaaacagcccctgtggagacgatgctctcatctgc
agctttcctgaggtacagtacttctcgtcctgtgtgctgctcagcctgctggcctgctcc
gtcttcctgcaggtcagcagtattggtaaactcttcctcatgctcttcattgagctgctc
tacctgctcatcatggaggtgcccaaagtgagcctgttcgacaaccaggacctactggtt
atggccaacgccatcaacgctgtcgagcaactgaatggaacaagctgtgtggtcgacacc
aaggttcctctgaggatcatgactccggtggtgatcacagtgtttgttctggctctctac
cttcacgcccagcaggtggagtccacagccaggctggacttcctctggaagctgcaggcc
acagaggagaaggaggagatggaggaacttcaggcctacaaccggcgtctcctccacaac
atcctgccgaaagacgtggccgctcacttcctgcagcgcgagcggcgaaacgacgagctc
tactaccagtcctgtgagtgcgtcgctgtcatgtttgcctccatcagtaacttctctgag
ttctacgtggagctggaggccaacaacgagggggtcgagtgtcttcggctgctcaatgaa
atcatcgccgactttgatgagatcatcagcgaggatcagttccgccagctggagaagatc
aagaccattggctccacctatatggcggcgtccggcctcaacgactccacgtacgacaag
gccgggcgctcgcacatccgagcactggctgactacgccatgaggctgatggaccagatg
aaatacatcaatgaacactcctttaacaacttcaagatgaaaataggtctgaacattggt
ccggtagttgctggggtaattggggccaggaagcctcagtacgacatctgggggaacaca
gtaaatgtggcaagtcgcatggacagcacaggtgtaccggagaggatccaggtgaccacc
gatctgtaccaggtactgagctcctataactacacactggaatacagaggcgtggtcaca
gtcaagggcaaaggggagatgatgacctacttcctcaccaatggaccctccagcagttaa

DBGET integrated database retrieval system