KEGG   Amphiprion ocellaris (clown anemonefish): 111574372
Entry
111574372         CDS       T06018                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1-like
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
aoce  Amphiprion ocellaris (clown anemonefish)
Pathway
aoce04012  ErbB signaling pathway
aoce04068  FoxO signaling pathway
aoce04110  Cell cycle
aoce04115  p53 signaling pathway
aoce04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:aoce00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    111574372
   04068 FoxO signaling pathway
    111574372
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111574372
   04115 p53 signaling pathway
    111574372
   04218 Cellular senescence
    111574372
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 111574372
NCBI-ProteinID: XP_023134692
Ensembl: ENSAOCG00000001609
LinkDB
Position
Unknown
AA seq 166 aa
MATHKRILSALGNGQARRNLFGPVDREQLQAEYQAALRKDLEEASKRWGFDFMSDKPLES
SDFQWEGIPGNRVPLLYRSCMLGLGKAEGERAAEKMVTARGGRVEPPQSEKENIPQTPAK
CKLSLDNLEKTPDRGENTGLKRKQTNLTDFYQAKRRVVWMPRKSGE
NT seq 501 nt   +upstreamnt  +downstreamnt
atggctactcacaagcggatcctgagcgccctggggaacggacaggcccggagaaacctg
ttcggcccggtggaccgagagcagctgcaggcggaataccaggctgccctgcgcaaggac
ttggaagaggcttcaaaacgctggggcttcgacttcatgtcagacaagcctctggagagc
agtgatttccagtgggagggcatcccaggcaacagggtgccactgctctatagatcctgc
atgctcggtctgggtaaggctgaaggcgagagggcagcagagaagatggttactgccaga
ggaggaagggtggagccaccacagagcgagaaggagaacatccctcagacaccagcgaaa
tgcaaactcagcctggacaacctggagaaaacaccagacagaggcgagaacacgggactg
aagaggaaacagacaaaccttacagatttctatcaggccaaaagaagagtggtttggatg
ccacgcaaatctggcgagtga

DBGET integrated database retrieval system