KEGG   Amphiprion ocellaris (clown anemonefish): 111575277
Entry
111575277         CDS       T06018                                 

Gene name
tgfa
Definition
(RefSeq) protransforming growth factor alpha isoform X1
  KO
K08774  transforming growth factor, alpha
Organism
aoce  Amphiprion ocellaris (clown anemonefish)
Pathway
aoce04010  MAPK signaling pathway
aoce04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:aoce00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111575277 (tgfa)
   04012 ErbB signaling pathway
    111575277 (tgfa)
SSDB
Motif
Pfam: EGF hEGF
Other DBs
NCBI-GeneID: 111575277
NCBI-ProteinID: XP_023136080
Ensembl: ENSAOCG00000010826
LinkDB
Position
Unknown
AA seq 268 aa
MMTRIFWDAVFLISGSFSMSVVLNGSLFTFGAGQSSSAIIEANISIDTNSTAAPNTSSSS
SVPPGSSDPTATVITTTETRIDTVKSSFFTFEEQQTNTTIDATISINTTSAAAPNISASS
SPATSSRDSTTKSLIPAAHATTIRPLKKFVAAAVRSHFDDCPDSQQHFCFHGTCRFLIQE
EAPACVCHPGFVGMRCEHADLLAVVATNHRQQTVATVLVLCVIGCVLIMVLCTLLHCWWR
QDCRRRSYAHHYVAEKHGVSCYPSESVV
NT seq 807 nt   +upstreamnt  +downstreamnt
atgatgactcggattttctgggatgcagtgttcctcataagcggttcttttagtatgtct
gtggtactcaacggttctctctttacgtttggagccgggcagagcagttcagcgattatt
gaagccaacatttccatcgatacaaactccaccgctgctccgaacacctccagtagcagc
tctgtgccgcccggcagcagcgacccgactgcaactgtgattacaacgacggagactcgc
atcgatacagttaaaagttccttcttcacatttgaggaacagcagacgaatacaaccatt
gatgccaccatttccatcaataccacctctgctgctgctcccaacatttcagcaagcagc
tctccagcaaccagcagccgagactccacaaccaagagcctcattcctgctgctcatgct
acaaccatccgcccgcttaaaaagtttgtggcggcggctgttcggtctcatttcgatgac
tgtccggattcccaacagcatttctgcttccatggcacatgtcgctttctgatacaggag
gaggcacctgcatgtgtgtgtcatccaggcttcgttgggatgaggtgtgagcatgcagac
ctgctcgccgtagtagcaaccaatcacaggcaacagaccgtcgccacggtgctggtgttg
tgtgtgattgggtgtgttctcatcatggtgttgtgtacactcttacactgctggtggagg
caggactgtcgcaggcggagctacgcgcatcactacgtggcagaaaagcacggcgtgtcc
tgctatccatctgagagtgtggtttga

DBGET integrated database retrieval system