KEGG   Amphiprion ocellaris (clown anemonefish): 111576239
Entry
111576239         CDS       T06018                                 

Gene name
ccnd1
Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
aoce  Amphiprion ocellaris (clown anemonefish)
Pathway
aoce04068  FoxO signaling pathway
aoce04110  Cell cycle
aoce04115  p53 signaling pathway
aoce04218  Cellular senescence
aoce04310  Wnt signaling pathway
aoce04340  Hedgehog signaling pathway
aoce04371  Apelin signaling pathway
aoce04510  Focal adhesion
aoce04530  Tight junction
Brite
KEGG Orthology (KO) [BR:aoce00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    111576239 (ccnd1)
   04340 Hedgehog signaling pathway
    111576239 (ccnd1)
   04371 Apelin signaling pathway
    111576239 (ccnd1)
   04068 FoxO signaling pathway
    111576239 (ccnd1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111576239 (ccnd1)
   04115 p53 signaling pathway
    111576239 (ccnd1)
   04218 Cellular senescence
    111576239 (ccnd1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111576239 (ccnd1)
   04530 Tight junction
    111576239 (ccnd1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 111576239
NCBI-ProteinID: XP_023137594
Ensembl: ENSAOCG00000021460
LinkDB
Position
Unknown
AA seq 292 aa
MEDQLLCCEVDSIRRAYQDVNLLNDRVLHTMLKAEENYLPSPNYFKCVQKEIVPKMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSVETTRKTRLQLLGATCMFLASKMKETVPLT
AEKLCIYTDNSVQPGELLQMELLVLSKLKWDLASVTPHDFIEHFLSKLKIYPSTKQILRK
HAQTFVALCATDVNFIASPPSMVAAGSVVAAVQGLYLKSQDASLSSQNLTNFLSRVIRSD
PDCLRSCQEQIESLLESSLRQAQQHSSTTETKRVDEDVDLSCTPTDVRDINI
NT seq 879 nt   +upstreamnt  +downstreamnt
atggaggaccagctgctgtgctgcgaggtggactccatcaggagagcctaccaggacgtc
aacctgcttaacgaccgagttctccacaccatgctgaaggcagaggaaaactacctaccg
tcgccaaactacttcaagtgtgttcagaaagaaattgtacctaaaatgaggaaaatagtt
gccacctggatgttagaggtctgcgaggaacagaaatgtgaggaggaggtttttccgctg
gctatgaactatttggacagatttttatcagtggagaccaccaggaaaacaagactacag
ctgcttggagctacatgcatgtttctagcatccaagatgaaggagactgtgcccttaacg
gcggagaaactctgtatctacacggacaactcggttcagcccggagaactgctgcaaatg
gagctacttgttctcagcaagctgaagtgggatctggcttcagtcactcctcacgacttc
attgagcatttcctgtccaagctgaagatatacccatctaccaagcagatcctcaggaaa
cacgcccagacctttgtggctctctgtgctacagatgtcaacttcattgccagtcctccc
tctatggtggcagcaggcagtgtggtggcagctgttcaaggtctctacctgaagagccaa
gatgcctctttgtcctcccagaacctcaccaacttcctgtcgcgggtcattcgcagtgac
ccggactgcttgaggtcatgtcaagagcagatcgagtctctgcttgagtcgagcctgcgg
caagctcagcagcacagcagcacaacagaaaccaaacgcgtggacgaggacgtggacctg
tcctgcacaccgacagacgttagagacatcaacatctga

DBGET integrated database retrieval system