KEGG   Amphiprion ocellaris (clown anemonefish): 111576401
Entry
111576401         CDS       T06018                                 

Gene name
stat3
Definition
(RefSeq) signal transducer and activator of transcription 3 isoform X1
  KO
K04692  signal transducer and activator of transcription 3
Organism
aoce  Amphiprion ocellaris (clown anemonefish)
Pathway
aoce04068  FoxO signaling pathway
aoce04217  Necroptosis
aoce04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:aoce00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    111576401 (stat3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    111576401 (stat3)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111576401 (stat3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:aoce03000]
    111576401 (stat3)
Transcription factors [BR:aoce03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    111576401 (stat3)
SSDB
Motif
Pfam: STAT_alpha STAT_bind STAT_int SH2 Syntaxin-6_N
Other DBs
NCBI-GeneID: 111576401
NCBI-ProteinID: XP_023137823
Ensembl: ENSAOCG00000014409
LinkDB
Position
Unknown
AA seq 784 aa
MAQWNQLQQLETRYLEQLYHLYSDSFPMELRQFLAPWIESQDWAYAANKESHATLVFHNL
LGEIDQQYSRFLQENNVLYQHNLRRIKQHLQSKYLEKPMDIARIVARCLWEEQRLLQTAT
SATQDGQAAHPTGTVVTEKQQILEHNLQDIRKRVQDMEQKMKMLENLQDDFDFNYKTLKS
QGELSQDLNGNSQAAATRQKMAQLEQMLSALDQLRRQIVTEMGGLLTAMDYVQKNLTDEE
LADWKRRQQIACIGGPPNICLDRLETWITSLAESQLQIRQQIKKLEELQQKVSYKGDPII
QHRPALEEKIVDLFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTNKVRLLVKFPELN
YQLKIKVCIDKESGDVAAIRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCG
NGGRTNSDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILW
YNMLTNHPKNVNFFTKPPVGTWDQVAEVLSWQFSSTTKRGLTIEQLTTLAEKLLGPCVNY
SGCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILS
PKPPGTFLLRFSESSKEGGITFTWVEKDISGKTQIQSVEPYTKQQLNSMSFADIIMGYKI
MDATNILVSPLVYLYPEIPKEEAFGKYCRPEAAPEPEMGGDSTSITQPYLKTKFICVTPC
PSVFMDLPDSELLGNGFPGTNSGNTSDLFPMSPRTLDSLMHNEAEANQGHLESLTLDMDV
ASPM
NT seq 2355 nt   +upstreamnt  +downstreamnt
atggcccagtggaaccagttacagcagctggagaccaggtatctggagcaactgtaccac
ttgtacagtgacagcttcccaatggagctacggcagttccttgccccctggattgagagt
caggactgggcttacgctgccaataaggaatcacatgccacattggttttccacaacctc
ttgggagaaatagaccagcagtatagccgtttcctgcaggagaacaatgtactctaccag
cataacctgcgcagaatcaaacagcatctgcagagcaagtacttggagaagccaatggat
attgcccgcattgttgctcgctgtttgtgggaggaacaaaggctgctgcagactgccacc
tctgctacacaggacggccaggcagcccatcctactgggacagtagtgacagagaagcaa
cagatactggagcacaaccttcaagatatcaggaagcgggtgcaggatatggaacagaag
atgaaaatgcttgaaaacttgcaagatgactttgacttcaattacaagactctgaaaagt
caaggagagttgtcccaggacctaaatggaaatagccaggctgctgccaccagacagaag
atggctcaactcgagcagatgctgagcgccctggaccagctcagaaggcaaattgtgaca
gagatgggaggattgctgactgccatggattacgtgcagaagaacctgacagatgaagaa
ctggcagactggaagagaagacagcaaattgcctgtattggaggtcccccaaacatctgc
ctcgatcgcctcgagacatggatcacatccttggctgagtcccagcttcagattcgtcag
cagatcaagaagctggaggagcttcagcagaaagtgtcctacaaaggagaccccatcatt
cagcaccggcctgccctggaggagaagattgtggatttgttcagaaacctcatgaagagt
gcttttgtggtggaaagacagccttgtatgcccatgcatccagacagacctctggtcatc
aaaacaggagtgcagttcacaaataaagtcaggctactggtaaagtttcctgaactcaat
taccagctgaaaattaaagtttgcattgacaaggaatctggggatgtggctgcaattcga
gggtcccgaaagttcaacatcctcggtaccaacacaaaagttatgaacatggaggaatcc
aacaatggcagcctgtcagcagagttcaaacacttgaccctgcgagaacagagatgtggt
aacggtggccggaccaatagcgatgcctctttgattgtgaccgaggaactccatcttatc
actttcgagacagaagtgtatcaccaaggcctgaagatagatctggagactcattccctg
cctgtggtagtcatttcaaacatttgccagatgcccaatgcctgggcctccatcctgtgg
tacaacatgctcactaatcacccgaagaatgtgaacttcttcacaaagcctccagttggg
acatgggaccaagtggccgaggtgttaagctggcagttctcatccactaccaagagaggc
ctgaccattgaacagctcaccacactggctgagaaactactagggccttgtgtcaactac
tctggatgtcagatcacctgggccaaattctgcaaggaaaacatggctggcaaaggcttc
tccttctgggtgtggctggacaacattattgacctggtgaagaagtatatcctcgccctg
tggaatgaagggtacatcatgggttttatcagtaaggagagggagagggccattctgagt
ccaaaacctcctggcactttcctgctgcgcttcagtgaaagcagcaaggagggcggcatc
acatttacttgggtagagaaggacatcagtggaaagacccagatccagtcagtggagcca
tacaccaagcagcagctcaacagcatgtctttcgctgatatcattatgggctacaagatt
atggacgccaccaacatcctggtttcacctctcgtttacctctatcctgaaatccccaaa
gaggaagcttttggaaaatactgcaggccagaagcagctcctgaacctgagatgggagga
gactcaacaagcattacccagccatacttaaagacgaagtttatctgcgtcaccccgtgt
ccctccgtgttcatggacttgccggacagtgagctgcttgggaacggattcccaggcaca
aactctggaaacaccagtgacctgttccccatgtcgcctcgcacccttgactccctgatg
cacaatgaagctgaagctaatcaaggacatttggagtcacttactttggatatggatgta
gcatcaccaatgtga

DBGET integrated database retrieval system