KEGG   Amphiprion ocellaris (clown anemonefish): 111577722Help
Entry
111577722         CDS       T06018                                 

Definition
(RefSeq) sodium-dependent noradrenaline transporter-like
  KO
K05035  solute carrier family 6 (neurotransmitter transporter, noradrenalin) member 2
Organism
aoce  Amphiprion ocellaris (clown anemonefish)
Brite
KEGG Orthology (KO) [BR:aoce00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:aoce02000]
    111577722
Transporters [BR:aoce02000]
 Solute carrier family (SLC)
  SLC6: Sodium- and chloride-dependent neurotransmitter transporter
   111577722
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SNF
Motif
Other DBs
NCBI-GeneID: 111577722
NCBI-ProteinID: XP_023139905
Ensembl: ENSAOCG00000007071
LinkDB All DBs
Position
Unknown
AA seq 623 aa AA seqDB search
MNIQVLPEHKLSSVAPLKQCNVEKKEVELILVKDQNGVQYTSSTIIPTPGHRAGPPGSED
ERETWGKKIDFLLSVIGFAVDLANVWRFPYLCYKNGGGAFLIPYILFLVIAGMPLFYMEL
ALGQYNREGAATVWKICPVFKGVGYTVIIIALYVGFYYNVIIAWSLYYLFSSMTSELPWL
RCGNSWNSPNCTDPKTINGSVLGNGTSYAKYKITPAAEYYERGVLHLHQSKGIQDLGLPR
WELTLCLVVVVFILYFSLWKGVKSSGKVVYITATMPYVVLFVLLIRGITLPGSMEGIKAY
LHIDFKRLNNLEVWIDAATQIFYSLGAGFGVLIAFASYNKFDNNCYRDALLTSTVNCVTS
FFSGFAIFSVLGYMAYKHGVRIEDVATEGAGLVFIIYPEAISTLPGSTFWAIVFFIMLLT
LGIDSSMGGMEAVITGLTDDFKILKRNRKLFTFATAFGTFLVALLCITNGGIYVLTLLDK
YAAGTSILFGVLIEAIGVSWFYGVDRFSEDIERMMGFKPGLYWRLCWKFVSPAFLLFVVI
ASTLTSSGLKYDEYVFPNWSNLVGWGVAMSSMLFVPFYAMYKFFSLPGTFKERIAYCITP
EHEHHLVAQGNVRQFTLKHWLAI
NT seq 1872 nt NT seq  +upstreamnt  +downstreamnt
atgaatatccaggttctgccagaacacaagctctcgtcggtggccccgctgaaacagtgc
aatgtggagaaaaaagaggtagaactgatactcgtgaaggaccagaatggcgtccagtac
accagttccaccatcattcccacccctggtcaccgcgcaggtccgcccggatccgaggac
gagcgagaaacttggggaaagaaaatagactttctcctgtcggtcattggcttcgcggtg
gacctggccaatgtttggagatttccttacttgtgctacaaaaatggaggaggtgccttt
ttgatcccctatattcttttcttggtcattgcggggatgccattgttctacatggaactt
gccttgggccagtacaacagggaaggggcagctacagtttggaaaatctgccctgtcttt
aaaggtgtgggctacactgtgattatcatagccctgtatgttggcttctactacaatgtc
atcatcgcctggtccctctactacctgttctcctccatgaccagtgagctgccgtggctc
agatgtggcaacagctggaacagtccgaactgcactgaccccaaaaccatcaatggatcc
gtcctcggcaatggcacgtcttatgccaagtacaagatcaccccggcagcagagtactac
gaacgaggtgtgctgcatctccatcaaagtaaaggtatccaggacctgggcttgcctcgc
tgggagttgaccctgtgcctggttgtggtggtcttcatcctctacttcagcctgtggaaa
ggtgtcaagtcttcgggaaaggtggtgtacattacagctactatgccctatgtggtcctt
tttgtgctgctgatccgaggcataactctaccagggtctatggaaggaattaaagcctac
ctccacattgacttcaagcgactcaacaatctagaggtgtggattgatgctgccacccag
atattctactcactgggtgcaggatttggtgtgctcattgcatttgccagttataacaaa
tttgacaacaactgctacagggatgctctcttgaccagcactgtgaactgcgttaccagt
ttcttctcagggtttgccatcttctctgtacttggatacatggcttacaaacatggggtg
agaatcgaggatgtggcaacagagggggcaggtttggtgtttatcatctacccagaggca
atttccaccctgcctggctcaacgttttgggcaattgtgttcttcattatgttgctgact
ctgggcattgacagctcgatgggtggcatggaggcagtgatcacaggcttgacggatgac
tttaagattctcaagagaaacagaaagctcttcacctttgccacggcttttggaactttc
ctggttgccctgctctgcatcaccaatggtggaatctatgtgctgacactgttagataag
tatgcagcagggacttctatattatttggtgtgttgatcgaggccattggagtgtcatgg
ttttatggtgtggatcgtttcagtgaagatattgagcgaatgatgggctttaagccagga
ctctactggaggctgtgctggaaatttgtcagcccagcgtttctgctgtttgtggtaata
gccagtactctgacatcatcaggcctgaagtacgatgagtatgtcttccccaactggtcc
aacctagtcggctggggtgtggccatgtcctccatgctgtttgttcccttttatgccatg
tataaattcttcagtctaccaggaacattcaaagagaggatagcctactgcatcactcca
gaacatgaacatcatttggtggctcaaggaaatgtacggcagttcacactcaagcactgg
ttggccatctag

DBGET integrated database retrieval system