KEGG   Amphiprion ocellaris (clown anemonefish): 111577772
Entry
111577772         CDS       T06018                                 

Gene name
cdkn1b
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
aoce  Amphiprion ocellaris (clown anemonefish)
Pathway
aoce04012  ErbB signaling pathway
aoce04068  FoxO signaling pathway
aoce04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:aoce00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    111577772 (cdkn1b)
   04068 FoxO signaling pathway
    111577772 (cdkn1b)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111577772 (cdkn1b)
SSDB
Motif
Pfam: CDI Herpes_LMP1
Other DBs
NCBI-GeneID: 111577772
NCBI-ProteinID: XP_023139970
Ensembl: ENSAOCG00000005606
LinkDB
Position
Unknown
AA seq 185 aa
MSDVRLSNGSPTLERTDPRVSEHPKPSACRSLFGSVDHEELKRDLKGHLRELEEAASAKW
GFDFANHTPLANGRLDWEQVDCRDVPDFYNRQPRREKGVCSAGNNNVDLNGNHNCVVVAP
SEDTGRSDGPMECTEQCTGMRKRPACHDPSAQNKRSHTSSEEVSCPSRSHSAEHTPRKTS
PKRQT
NT seq 558 nt   +upstreamnt  +downstreamnt
atgtcagatgttcgactttcaaacgggagcccgacgctggagcggacggacccccgggtg
tcggagcacccgaagccgtcagcctgcaggagtctgttcggctcggtggatcacgaagag
ttaaagagggatttaaagggacatttgcgggagctggaagaggcagcctccgccaagtgg
ggcttcgacttcgccaatcacacgccgctggccaacggcaggctcgactgggaacaagtg
gattgcagagacgtcccggatttctacaaccggcagccgcggagggagaaaggcgtctgc
tccgctgggaataacaatgtggatctaaatgggaatcataactgtgttgtggtggctccg
agcgaagacacgggcaggtccgacgggccgatggagtgcacggagcagtgcaccgggatg
aggaaaagacctgcatgtcacgacccctcggcccaaaacaagaggtcacacaccagctcg
gaggaggtcagctgtccgagccggagccactctgcagaacacacacccagaaagaccagt
cccaagaggcaaacgtga

DBGET integrated database retrieval system