KEGG   Amphiprion ocellaris (clown anemonefish): 111579908
Entry
111579908         CDS       T06018                                 

Definition
(RefSeq) ras association domain-containing protein 1-like isoform X1
  KO
K09850  Ras association domain-containing protein 1
Organism
aoce  Amphiprion ocellaris (clown anemonefish)
SSDB
Motif
Pfam: RA Nore1-SARAH C1_1 Ras_bdg_2 DUF5113
Other DBs
NCBI-GeneID: 111579908
NCBI-ProteinID: XP_023143194
Ensembl: ENSAOCG00000010881
LinkDB
Position
Unknown
AA seq 365 aa
MSWGEFIELRDLKSSKEQIELTGSRSPCSPPRLERTNALRISPGKVPDLLSRVGIIRVLS
SSQDPQLPEEKGEGHNFQPCSHAQPTWCDLCGDFIWGLYKQSLRCVNCRFTCHYRCRALI
QLDCSWERNSAADHTCVVEHAIETDTNVDEQIDSGKQELTAADVQQKVKEYNAQINSNLF
MNMNKDGSYTGFIKVQFKLARPVSVPAPKKGSHDAGGRRSSGVKRRTSFYLPKDASKHLH
ISSRTSAREVIEALLKKFTVVDNPGKFALFERSERHDQVYVRKLSDDERPLRLRLCAGPN
EKILSFVLKENETGEVNWHAFSMPELKNFLRILQREEEEHVKQIVQRYALARTKMQEALA
GSTPG
NT seq 1098 nt   +upstreamnt  +downstreamnt
atgtcttggggggagttcatcgagctccgtgacctgaagtccagcaaagagcagatagag
ctgactggctcacgttcaccatgctcgcctccacgcctggagagaaccaacgccctgagg
atcagcccgggcaaagtcccggacctgctgagccgggtgggcatcatcagagtcctgagc
agcagccaggacccccagctcccagaggagaagggagaagggcataacttccaaccctgc
agccacgctcagcccacgtggtgcgacctgtgtggagacttcatctggggcctttacaag
cagagcctgcggtgtgtcaactgtagattcacatgccactaccgctgtcgtgccctgatt
cagttggactgcagctgggaacgaaactctgcggccgaccacacttgtgttgtcgagcac
gccatagaaacggacacaaatgtggatgaacaaatcgactcgggcaaacaggagttgaca
gctgcagatgttcagcagaaggtgaaggaatacaatgctcagatcaacagcaatctgttc
atgaacatgaacaaggacgggtcctacactggcttcattaaggtgcagttcaagttggca
cgacctgtgtcagttccagctccaaagaaaggaagtcacgatgctggagggaggaggtcc
agtggagtgaagcgccgcacctccttctacctgccaaaagacgcatccaagcatttgcac
ataagttcacgtacttctgctcgtgaagtcatcgaggctttactgaaaaagtttactgtt
gtggacaaccctggcaagtttgctctgtttgagcgcagcgagcgtcatgaccaagtttat
gttcgtaaactgtctgatgatgagcgtcccctccgtctgcgtctatgtgccgggcccaat
gagaaaatcctcagctttgtgctcaaagagaatgaaactggcgaagtcaattggcatgcc
ttctccatgcccgagctgaagaacttcctgcgcatcttgcagcgtgaagaagaggagcat
gtcaaacagatcgtgcaacgttacgctttggctcgcactaagatgcaggaggctctggct
ggctcgaccccaggctga

DBGET integrated database retrieval system