KEGG   Amphiprion ocellaris (clown anemonefish): 111581874
Entry
111581874         CDS       T06018                                 

Definition
(RefSeq) uncharacterized protein LOC111581874
  KO
K05461  KIT ligand
Organism
aoce  Amphiprion ocellaris (clown anemonefish)
Pathway
aoce04010  MAPK signaling pathway
aoce04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:aoce00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111581874
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    111581874
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:aoce04052]
    111581874
Cytokines and growth factors [BR:aoce04052]
 Growth factors
  Growth factors (RTK binding)
   111581874
SSDB
Motif
Pfam: SCF
Other DBs
NCBI-GeneID: 111581874
NCBI-ProteinID: XP_023146021
Ensembl: ENSAOCG00000011259
LinkDB
Position
Unknown
AA seq 253 aa
MRKKILKAPCLFLSLITSLNLCSGKFGAPITDDVSKLSILKQNIPSDYEIPVSYIPKEVA
GTCWVVLNIYPLEQSLRKLANMFGAISSNKENIIVFIAMLKSLRFTFDHEELETAMQVFQ
CHYQEGSLLSGLYFDYIKDVLQSAAQGTSGFSCKPPPCGNPQHTPGSQEENHSYSWSRRS
PLLLVLIPFIACVVLIVWLVKSGRRLPMCNTENSQMAPSDMIPTVSISIPLQTLAHAADT
QPAGEAIAEHESG
NT seq 762 nt   +upstreamnt  +downstreamnt
atgaggaagaaaatcttgaaagcaccttgcctcttcttgagtctaataacaagtctgaat
ctctgctctggaaaatttggagctccaataactgatgatgtgagcaagctgtcaatattg
aagcagaatattccctccgattatgagattcctgttagctacattcccaaagaagtggct
ggcacgtgctgggtggtgttaaatatctatcctttggagcaaagtctgcgcaagctggcc
aacatgttcggtgccatctcctccaacaaagaaaacatcatcgtcttcattgcgatgctc
aagagtttacgcttcaccttcgaccacgaagaactggaaacggcgatgcaagtcttccag
tgtcactatcaggaaggcagcttactgtctggtctttacttcgactacatcaaagacgtc
ttacaatctgccgctcaaggaacatccggcttctcatgcaagccgccgccatgcggtaat
ccccaacacacaccagggagtcaggaagagaatcatagttacagctggtcccggagatct
cctttgctgctggttctcatccccttcatagcttgtgttgttctcatagtttggctggtc
aagtctggaaggcgtttaccgatgtgcaacactgaaaatagccaaatggcaccttctgac
atgatcccaactgtgtctatctccatcccacttcaaacactcgcccacgccgctgacact
cagccggcaggggaggcaattgccgaacatgaaagtggatga

DBGET integrated database retrieval system