KEGG   Amphiprion ocellaris (clown anemonefish): 111582017
Entry
111582017         CDS       T06018                                 

Definition
(RefSeq) optineurin-like isoform X1
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
aoce  Amphiprion ocellaris (clown anemonefish)
Pathway
aoce04010  MAPK signaling pathway
aoce04210  Apoptosis
aoce04620  Toll-like receptor signaling pathway
aoce04621  NOD-like receptor signaling pathway
aoce04622  RIG-I-like receptor signaling pathway
aoce04623  Cytosolic DNA-sensing pathway
aoce04625  C-type lectin receptor signaling pathway
aoce04920  Adipocytokine signaling pathway
aoce05132  Salmonella infection
aoce05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:aoce00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111582017
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    111582017
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111582017
   04621 NOD-like receptor signaling pathway
    111582017
   04622 RIG-I-like receptor signaling pathway
    111582017
   04623 Cytosolic DNA-sensing pathway
    111582017
   04625 C-type lectin receptor signaling pathway
    111582017
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111582017
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111582017
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    111582017
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aoce01001]
    111582017
Protein kinases [BR:aoce01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   111582017
SSDB
Motif
Pfam: NEMO CC2-LZ zf_C2H2_10 APC_N_CC
Other DBs
NCBI-GeneID: 111582017
NCBI-ProteinID: XP_023146244
Ensembl: ENSAOCG00000000302
LinkDB
Position
Unknown
AA seq 616 aa
MVQPQPDGPMQWDMSGEDSGGALRVPPELAANEVVTRLLGDNQQLREALRRSNLALRQRC
EEMEGWQRRTREEREFLSCRFQEARALVERLAQENHSLQGLVNGPASSSSNHCCSSSQTE
DLQGRPARNGPADGPQVSQTLDHWDRKRVEDTEQYTQTTPPRSLDDASVSIFLSHAVTSS
PTSFSEEQGDPVEGANDFLQLLKSHKEKLEEGMRELRRKNEELEREKDEGDVERERMRRC
IDQLRAKLAQAQASGATEDVVPHRSEAQHSSDCSSLAKLTEQLQATQGRYRELEEKLDYL
QKSSAQRDRTEALLKQKDKDCAQLAKDCEALKAQATSLLGELKERQSCLDKSEMERKMLE
EKLCSKVKALQVAEREQEQQRKQHHVAMDKLLLQTQSLEQALKTERHVVTEEKKKLTQLQ
HAYTCLFRDYDSKLKSEGGDLCSRLEEAERALALKQDLIDKLKEEVEQQKGSLETVPVLT
AQAEIYKADFLAEREAREKLNQKKEELQDQLNQAMTEIERLKQEATSRARMEQMKLRHLE
DFPARPPHIPPPPGVFPGAAFNTVPPASSFRHQGPIPVGDQGAAGVEDLPDLCCPKCQYL
APDMDTLQIHVMDCIQ
NT seq 1851 nt   +upstreamnt  +downstreamnt
atggtgcagcctcaacctgatggtccgatgcagtgggacatgtccggagaggatagtgga
ggggccctcagggtcccaccagagctggctgccaatgaagtagtgaccagattgctgggt
gacaaccagcagcttagagaggctctgcggcggagcaatctagccttgcgtcagcgctgc
gaggagatggagggatggcagcggagaacgagagaggagcgagagtttctcagctgtcgt
ttccaggaggctagggcgctggtggagaggctggcccaggagaaccactccttacagggc
ctggtgaacggaccggcgtcctcctcctccaatcactgctgcagctccagccagactgaa
gacctgcagggacgtccagccaggaacgggccggcggacggaccacaggtgagccagact
ctagaccactgggacaggaagagagttgaagatacagaacaatacacgcaaaccacacct
cctcgcagcctggatgacgcaagtgtgagtatattcttgagtcatgcagtcacctcgtcc
ccaacctcattttcagaggaacagggagatcctgtggaaggtgcaaacgatttcctgcag
ctgctgaagagccacaaagagaagctggaagaaggtatgcgagagctgaggaggaagaac
gaagagctggagcgggagaaggatgaaggagacgtagagagagagcgaatgcgtcgctgc
atcgaccagctaagagccaaactggcccaggcacaggcgagcggtgctactgaggacgtt
gttccacatcgctctgaggcgcagcactcctccgactgctctagcctagctaaactcaca
gagcagcttcaggccacacagggcaggtatcgggagctggaggagaaactcgattacctg
cagaagagttcggctcagcgggacagaactgaagctctgctcaaacagaaggacaaggac
tgtgctcagctggccaaggattgcgaggccctgaaagctcaggcaacctccctgttagga
gaattgaaggagaggcagagctgcttggacaagagcgagatggagcgcaaaatgttggaa
gagaagctgtgcagtaaggtgaaggccctgcaggtggcagagcgagagcaggagcagcag
aggaagcagcatcatgtggccatggacaagctgctgctgcagacccagagcctggagcag
gccttgaagacagaaagacatgtggtcacagaggagaagaaaaaactgacacagctgcag
catgcctacacatgcctcttcagagactacgattccaaactgaagagtgagggaggagat
ctgtgcagccgactggaggaggcggagcgagctttggccttgaaacaggacctgattgat
aaactgaaggaggaagtggagcagcagaaaggctctctggagactgttcctgtcctcacc
gctcaggctgagatctacaaggcagatttcctggcggagcgagaagcgagagagaagctg
aaccagaagaaggaggaactgcaggatcagctgaatcaggccatgactgagatcgagaga
ctcaagcaagaagccacatcacgtgcacgtatggagcaaatgaagctgagacacctggaa
gactttcctgcacggccaccgcacattccccctccaccaggtgtgttccctggtgcagct
ttcaacacggtgcctcctgcctcctcattccgccatcagggtccgataccagttggcgat
caaggagctgccggagtcgaggacctgccagatttatgttgtcctaagtgccagtacctg
gctccagatatggacacgctgcagattcacgtcatggactgtatacagtaa

DBGET integrated database retrieval system