KEGG   Amphiprion ocellaris (clown anemonefish): 111582710
Entry
111582710         CDS       T06018                                 

Definition
(RefSeq) transcription factor p65-like isoform X1
  KO
K04735  transcription factor p65
Organism
aoce  Amphiprion ocellaris (clown anemonefish)
Pathway
aoce04010  MAPK signaling pathway
aoce04137  Mitophagy - animal
aoce04210  Apoptosis
aoce04218  Cellular senescence
aoce04620  Toll-like receptor signaling pathway
aoce04621  NOD-like receptor signaling pathway
aoce04622  RIG-I-like receptor signaling pathway
aoce04623  Cytosolic DNA-sensing pathway
aoce04625  C-type lectin receptor signaling pathway
aoce04920  Adipocytokine signaling pathway
aoce05132  Salmonella infection
aoce05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:aoce00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111582710
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    111582710
  09143 Cell growth and death
   04210 Apoptosis
    111582710
   04218 Cellular senescence
    111582710
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111582710
   04621 NOD-like receptor signaling pathway
    111582710
   04622 RIG-I-like receptor signaling pathway
    111582710
   04623 Cytosolic DNA-sensing pathway
    111582710
   04625 C-type lectin receptor signaling pathway
    111582710
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111582710
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111582710
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    111582710
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:aoce03000]
    111582710
Transcription factors [BR:aoce03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    111582710
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer
Other DBs
NCBI-GeneID: 111582710
NCBI-ProteinID: XP_023147306
Ensembl: ENSAOCG00000022580
LinkDB
Position
Unknown
AA seq 641 aa
MLGCIAGVYGWGMAPINPVQTASPFIEIIEQPKQRGMRFRYKCEGRSAGSIPGEKSNDTT
KTHPAIKVHNYNGPLRVRISLVTKNAPYKPHPHELVGKDCRHGYYEADLLERRIHSFQNL
GIQCVKKKDVNEAITCRLQTNNNPFNIPEPKVWEEEFDLNSVRLCFQASITLPTGELFPL
EPVVSQPIYDNRAPNTAELKICRVNRNSGSCKGGDEIFLLCDKVQKEDIEVRFFQDSWEG
KGTFSQADVHRQVAIVFRTPPYRDTNLSEPIRVKMQLRRPSDREVSEPMDFQYLPADPDE
YRLSEKRKRTGDMFQKLGPMLSTVSIPQDRRHISPARRIPPAKLPAMNAQAAAVVPPGAS
GAKPQPSYSYNQPGQLFSVQPKVEVSSSISAATTSQTWKIMESLNLGSQPKATPVSNFTM
SPAAAAAAPSSSSTTTPSANQDYSTVNLSDLHEFFPMSSGIPQEPAASQGNAASSQTSSS
FTLQGSQFRVEAPLVDEDIPEFPSFSEAQVPSVLESLNMDDFVELLNPRLMSEAGDGTAM
LGQISSQSAVPPSSSAAAQSSAASQNTSDPAGNPGSPWMNYPNSIVHLLQNEGMIGIPPS
NNNHQPAVLDEFDELMSADEDRLISILNSGSQVGFVSGHPT
NT seq 1926 nt   +upstreamnt  +downstreamnt
atgctgggatgcatcgcaggtgtgtatggatggggcatggctccaatcaacccagtccaa
acagcgagccccttcatagagataatcgagcagccgaaacagaggggaatgaggtttaga
tataagtgtgagggacgttcagctggcagtatccccggagagaagagcaacgacaccact
aaaacccacccggccatcaaggtgcacaactacaacggcccgctgcgcgttcgcatctcg
ctggtgacgaagaatgcgccgtacaagcctcacccccacgagctggtcgggaaggactgc
agacacggatactacgaggccgacctgctggagagacgaatacacagttttcagaacctg
ggtattcagtgcgtgaagaagaaggatgtgaacgaggccatcacttgcagactgcagact
aataataatcccttcaacatccccgagccgaaggtgtgggaggaggagtttgacctgaat
tcagtccggctttgcttccaggcctcgatcactctgcctacgggggagctgttccctctg
gagcccgtcgtatcgcagcccatctatgacaacagggctccaaacacagctgagttgaag
atctgcagagtcaaccgcaactctggaagctgcaaaggaggggatgaaatcttcctgctg
tgcgacaaagtgcaaaaagaggatatcgaggtgcgattcttccaggactcctgggagggg
aagggcactttctcccaagctgacgtccacaggcaggtggccattgtgttccggacgcct
ccctaccgcgacactaacctcagtgagcccataagagtcaaaatgcagctccggcggccc
tcggaccgagaggtcagcgagccaatggatttccagtacctgccagccgacccagatgaa
tacaggctgagtgaaaagagaaagcgcacaggagacatgttccagaagctggggcccatg
ttatccactgtgtccatcccacaagacagacggcacataagcccggcgaggagaataccc
ccagccaagcttccagcaatgaacgcccaagctgcagctgtagtgccccctggtgccagc
ggggcgaaaccccagccctcctactcgtacaatcagccaggccagctcttctcagtgcag
cccaaagttgaggtctcctcttccatctcagccgcaaccaccagccaaacatggaagatc
atggagagtctgaacctcggctcccagcccaaagccactccagtttccaactttacaatg
agcccagcagcagcagcagcggctccatcctcctcctctaccaccaccccctctgcaaac
caggactactccacggtcaacctctcagaccttcatgagttcttccccatgtcctccggc
atcccccaggagccggcagcctcccaaggaaatgcagcctcctcacagacaagcagctcc
ttcaccctccagggctctcagttccgggtggaagccccgcttgtggacgaggacatccca
gagttccccagcttttccgaagcccaggtcccaagcgtgctggagagcttgaacatggat
gactttgtggaacttctgaacccccgcctcatgagcgaggctggggacggtaccgctatg
ctgggccagatttcaagccaatcagctgtccctcccagctcctctgctgccgcccagagc
agcgctgcctcccagaacacttctgaccctgccggcaacccaggcagcccctggatgaat
taccccaacagcatcgtccacctgctacagaacgagggcatgatcggcatcccgcccagc
aacaacaaccaccagcctgcggttcttgacgagttcgacgagctcatgtccgccgacgaa
gaccgtcttatttccattttgaacagcggaagccaagttggttttgtgtctggacaccca
acttaa

DBGET integrated database retrieval system