KEGG   Amphiprion ocellaris (clown anemonefish): 111583868
Entry
111583868         CDS       T06018                                 

Definition
(RefSeq) putative fibroblast growth factor 1 isoform X1
  KO
K18496  fibroblast growth factor 1
Organism
aoce  Amphiprion ocellaris (clown anemonefish)
Pathway
aoce04010  MAPK signaling pathway
aoce04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:aoce00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111583868
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111583868
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:aoce04052]
    111583868
   00536 Glycosaminoglycan binding proteins [BR:aoce00536]
    111583868
Cytokines and growth factors [BR:aoce04052]
 Growth factors
  Growth factors (RTK binding)
   111583868
Glycosaminoglycan binding proteins [BR:aoce00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   111583868
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 111583868
NCBI-ProteinID: XP_023148882
Ensembl: ENSAOCG00000003977
LinkDB
Position
Unknown
AA seq 182 aa
MLAHQWHCHKSFSQTQGHHSAESTPPALYRMTEGDVTVLPFGPATLDLSKQEQHTLTRLY
SKNGGYHLRILPDGTVSGGRQENDPYDILRVKAVSAGVVVIKGEVTGRYLAMNKNGRLYG
SQALNDECYFLETYEENHYNTYRSQKYSWYVALKRNGQPKAGPDTHQGQKAIFFLPRSAG
NM
NT seq 549 nt   +upstreamnt  +downstreamnt
atgctggctcatcagtggcactgtcataaaagtttctcacagacacaaggtcatcactct
gctgagtccacacctcctgctctctataggatgactgagggagatgttacagtgctgcca
ttcggaccagcaactttggatctgtccaagcaggagcagcacaccctgaccagactatac
agtaagaatggaggatatcacctgaggattctaccagatggaaccgtgagcggtgggagg
caggaaaatgacccctatgatatcctgagggtgaaggctgtgagtgcaggagtggtggtc
atcaaaggtgaagtgacaggacgttacctggccatgaacaaaaatggacgcctctatgga
tcacaagcactgaatgatgagtgttacttcctggagacgtatgaagagaaccactacaac
acgtatcgctctcagaagtacagctggtatgttgccttgaagaggaatggccagcccaaa
gcaggaccagacacccaccagggtcagaaggccatcttttttctgccacgctctgcaggc
aacatgtaa

DBGET integrated database retrieval system