KEGG   Amphiprion ocellaris (clown anemonefish): 111585907Help
Entry
111585907         CDS       T06018                                 

Definition
(RefSeq) transketolase-like
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
aoce  Amphiprion ocellaris (clown anemonefish)
Pathway
aoce00030  Pentose phosphate pathway
aoce01100  Metabolic pathways
aoce01200  Carbon metabolism
aoce01230  Biosynthesis of amino acids
Module
aoce_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
aoce_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:aoce00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    111585907
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    111585907
Enzymes [BR:aoce01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     111585907
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transketolase_N Transket_pyr Transketolase_C DXP_synthase_N E1_dh XFP_N TPP_enzyme_C Aminotran_MocR
Motif
Other DBs
NCBI-GeneID: 111585907
NCBI-ProteinID: XP_023151316
Ensembl: ENSAOCG00000021280
LinkDB All DBs
Position
Unknown
AA seq 628 aa AA seqDB search
MEDYHKPDQQTVQALRNIATRLRINSIKATTAAGSGHPTSCCSVAEIMSVLFFHSMKYRP
EDPRNPNNDRFILSKGHAAPVLYAVWAETGYLKENELLNLRKVDSILEGHPVPKQQFVDV
ATGSLGQGLGAACGMAYTGKYFDKASYRVFCLLGDGELSEGSVWEAMAFASYYQLDNLVA
ILDINRLGQSDPTPLQHHVEKYQRRCEAFGWHAIIVDGHSVEELCKVLSQPRHQPLAIIA
KTIKGKGIPAAEDKMGWHGKPLPKDMAEGVIKELQSRIISCNKRLYPAPPNDDTSPVSLR
NVRMPSAPSYKPGDKIATRKAYGMALAKLGRYNEHVVALDGDTKNSTFSELFKNEHPNRY
VECYIAEQNMVSMAIGCAVRDRNVVFASTFATFFSRAYDQLRMAAISESNINLCGSHCGV
SIGEDGPSQMGLEDLAMFRAIPTATVFYPSDGVSTEKAVELAANTKGLCFIRTSRPENNI
IYNCNEDFHVGQAKVVYKTNDDHVTVVGAGVTLHEALAAADMLKKERINIRVIDPFTIKP
LDHKTIIDNARATRGRIITVEDHYYEGGLGEAVCSAVVNETGFTVHRLAVSQVPRSGKPQ
ELLRIFGIDRDAIAQAVRKVLSSSANAK
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atggaggactaccacaaaccggaccagcagacggtgcaggcgctgaggaacatcgccacc
cggctccggatcaactccatcaaggcgacaactgcggcgggcagcggccatcccacatca
tgctgcagcgtggcagagatcatgtctgtgctcttcttccattccatgaaataccgacct
gaagaccctcgaaaccccaacaacgaccgcttcatcctctccaagggtcatgcagctccg
gtgctgtacgccgtgtgggcagaaaccggatacctgaaggagaacgagctcctgaacctc
cggaaggtggactccatcctggagggacatccagtaccgaagcagcagtttgtggatgtg
gccaccggatctctgggccaggggctgggagctgcctgtggaatggcctacacggggaag
tacttcgacaaggccagctatcgggtgttctgcctgctgggggatggagagctgtcggag
ggctcggtgtgggaggccatggccttcgcctcctactaccagctggataacctggtggcc
atcctggacatcaaccgtctgggtcagagcgacccgactccactgcagcaccacgtggag
aagtaccagcgacgctgcgaggccttcggctggcacgccatcatcgtggacggccacagc
gtcgaggagttgtgtaaggtgttgagtcagcctcgtcaccagccgctcgccatcatcgcc
aagaccattaaaggcaaaggaatcccagctgctgaggataagatgggctggcatggcaaa
ccgctgcccaaagacatggctgaaggagtgatcaaggagctgcagagtcgcatcatcagc
tgcaacaagcgcctctatcctgctcctcccaacgacgacacgtcacccgtcagcctccgc
aacgtccgcatgcccagcgctccgagctacaaacccggagacaagatcgccaccaggaag
gcgtacggcatggcgctggccaagctgggccgctacaacgagcacgtggtggctctggat
ggagacaccaagaactccaccttctccgagctctttaagaacgaacaccccaaccgctac
gtggagtgttacatcgcagagcagaacatggtgagcatggcgatcggttgtgctgttcgg
gatcgtaacgtggtgttcgccagcaccttcgccaccttcttcagccgagcctacgaccag
ctccgcatggccgccatctccgagagcaacatcaacctgtgtggctcccactgtggcgtc
tccatcggtgaggatggaccttctcagatgggtctggaggatctggccatgttcagagcc
atccccacggcgaccgtcttctatccgagcgacggcgtctccactgagaaggctgtggag
ctcgctgccaacacaaagggtttgtgtttcatccgaacaagccgcccagagaacaacatc
atctataactgtaacgaagactttcatgtcggacaagctaaggttgtgtataaaaccaac
gatgaccacgtgactgtggttggagcaggagtgactcttcatgaggctctggctgctgct
gacatgctcaagaaagagagaatcaacatccgtgtgatcgacccgttcaccatcaaacct
ctggaccacaagaccatcatcgacaacgccagggccaccagaggacgcatcatcaccgtg
gaggaccactactatgaaggtggtctgggcgaggcggtgtgttcagcggtggtgaatgaa
accggcttcaccgtccaccgcctggccgtttcccaggtgccccggagcggcaaaccccag
gagctgctccggatcttcggcatcgaccgcgacgccatcgctcaggcggtccggaaggtt
ctcagcagctcggccaacgccaagtag

DBGET integrated database retrieval system