KEGG   Amphiprion ocellaris (clown anemonefish): 111588972
Entry
111588972         CDS       T06018                                 

Definition
(RefSeq) adenylate cyclase type 3-like isoform X1
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
aoce  Amphiprion ocellaris (clown anemonefish)
Pathway
aoce00230  Purine metabolism
aoce01100  Metabolic pathways
aoce04020  Calcium signaling pathway
aoce04114  Oocyte meiosis
aoce04261  Adrenergic signaling in cardiomyocytes
aoce04270  Vascular smooth muscle contraction
aoce04371  Apelin signaling pathway
aoce04540  Gap junction
aoce04912  GnRH signaling pathway
aoce04914  Progesterone-mediated oocyte maturation
aoce04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:aoce00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    111588972
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    111588972
   04020 Calcium signaling pathway
    111588972
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    111588972
  09144 Cellular community - eukaryotes
   04540 Gap junction
    111588972
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    111588972
   04914 Progesterone-mediated oocyte maturation
    111588972
   04916 Melanogenesis
    111588972
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    111588972
   04270 Vascular smooth muscle contraction
    111588972
Enzymes [BR:aoce01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     111588972
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA fn3_4 DUF1053 OPA3
Other DBs
NCBI-GeneID: 111588972
NCBI-ProteinID: XP_023155399
Ensembl: ENSAOCG00000023529
LinkDB
Position
Unknown
AA seq 1123 aa
MPRNRAFSEPEYSAEYSADCSVTLPSDPGQAVGRTHEVTVRSSGCCLCLPRFMRLTFAPE
SLENLYQTYFRRQRHETLLVLVVFAALFDSYIIVMCAVVYTTDKLASVLVASVGLAADII
LYLLCRHGLLPDRISRRVVPYALWVLIAAQIFCYLGLNYARFHQASDTVGWQAFFSFSFF
LTLPLRLTPIVLITTVSCGVHTLVLGVTIAQQQQEDIQGAALGRQLLANIVIYVCAITVG
VMSYYMADRKHRKAFLEARQSLEVKLNLEEQSQQQERLLLSILPKHIADEMLQDMKKEPS
QKEMQQFNTMYMYRHENVSILFADIVGFTQLSSSCSAQELVKLLNELFARFDKLAAKYHQ
LRIKILGDCYYCICGLPDYREDHAACSIMMGLAMVEAISYVREKTQTDVDMRVGVHSGTV
LGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQSTMECLHGEFDVEPGNGGDRCD
YLRERGIETYLVVVPKGPLGKSGINGVKLSVTSSNGNSPLLINTTECNGSVNTACTTPEE
PEELDARVVNPSFPNPRRRLRLRDLAERVIDAQENEQELNKLLNEALLERETVQVLKGKH
TNRLSLRFVDPDLETRYSVEKEKQSGAAFCCSCVVLLFTAVMEALIDPWLIANYITFAVG
EVLLLVLTICSLAAIFPRVFPKKLVSFSTWIDHTRWARNTWAMAAIFILTMADIMDMLSC
LPEVPDSGSTTVAPSSSSSSSTWSGLEGCLNNPKYYSYIAVLALMATNMLVQVSHMVKLT
LMLLITVATGIVNIYSWKDIFDRYDMARFQDYRSYLVPSKFTMTIMIFIMMGSFYYFSRH
VEKLARTLFLWKIEVHEQKEKVYEMRRWNEALVTNMLPEHVARHFLGSKKRDEELYSQSY
DEIGVMFASIPNFSDFYTEESINNGGIECLRFLNEIISDFDSLLDEPQFRCITKIKTIGS
TYMAASGVTADVSNGYSCMKKEEQSDKERWQHLADLADFALAMKVTLMNINYQSFNNFML
RIGLNKGGVLAGVIGARKPHYDIWGNTVNVASRMESTGVMGNIQVVEDCYNILKEYSFRF
VRRGPIFVKGKGELLTYFLKGRDKQGSFINSSSVTLPHQVVDS
NT seq 3372 nt   +upstreamnt  +downstreamnt
atgcctcggaaccgagcgttttctgagccagagtactcagcagagtactcagcagactgt
tctgtaacgttgccctctgacccagggcaggcagtggggcgaacacatgaggtcacggta
cggagttcaggatgctgcctttgcctgcctcgattcatgcgtctcacctttgcacctgag
tctctggagaacctctaccagacctatttcagacgtcaaagacatgaaaccctgctggtg
cttgttgtgtttgctgcactgtttgacagctacatcatcgtcatgtgtgcggtggtctac
actactgacaagctggcttctgttttagtagcatcagtggggctggcagcagatattatc
ctctacctactgtgccgccatgggctgctgccagaccgcatctcacgacgggtggtgcca
tacgccctctgggtgctcatagcagctcagatattctgctacctgggtctgaactatgct
cgcttccaccaggccagtgacacagtgggctggcaggccttcttcagcttctcctttttc
ctaactctgcctttgagactgacacctattgtgcttatcactactgtgtcctgtggggtc
cacaccctggttctaggtgtcaccatcgcccagcagcaacaggaggacattcagggcgca
gcacttggccgacagctactggccaacattgtgatatatgtttgtgccatcactgtggga
gtcatgtcatactacatggctgaccggaagcatcggaaggcattcctggaggcgagacag
tcactggaggtcaaactgaacctggaggagcagagccagcaacaggagcgtctcctgctc
tccattcttccaaagcacatagctgatgagatgcttcaggacatgaagaaggagccaagt
cagaaagagatgcagcagttcaacaccatgtacatgtacagacatgaaaatgtcagtatt
ttgtttgcagacatcgttggcttcacccagctgtcatcatcttgcagcgctcaggagctg
gtcaaactgcttaatgaactctttgctcgatttgacaagctggctgcaaaatatcaccag
ctgcggataaagatcctgggagactgctactactgtatctgtgggctgccagactacagg
gaggaccatgctgcctgctccatcatgatgggcttggccatggtggaagccatctcgtac
gtccgagagaaaacccagactgatgttgacatgcgggttggagtgcacagtggcacagtc
ctgggtggagtgctgggccagaaacgctggcagtatgatgtttggtccacagacgtcact
gtggccaacaaaatggaagctggagggataccaggtcgtgttcacatctcacagagcacc
atggagtgtcttcatggggagtttgatgtggagccaggtaatggaggggaccgttgtgac
tacctgagagagagaggcatcgagacttacctggttgttgttcctaaaggacctttaggc
aagagtggcataaatggtgtgaagctgtctgtaacatcatccaatggaaactctccactg
ttaatcaacaccacagagtgtaacggcagtgttaacacagcctgcaccacaccagaggaa
ccagaagaactggatgcaagggtggtaaatccttctttccctaaccctcggagaaggcta
cggctacgggacctggctgaaagggtgatcgatgctcaggagaatgaacaggagctcaac
aaactgctaaatgaggctctgctggagagagagacagttcaagttctgaaggggaaacac
accaacaggctctcgctgagatttgtggatccagacctggaaactcgttactctgtggag
aaggaaaaacagagcggagcagccttctgctgctcttgtgtggttctgctcttcactgca
gtaatggaggccctcatagacccctggctgattgcaaactacatcacctttgcagtgggg
gaggtcctgctgcttgtcctgacaatctgttccctggctgccatctttcctcgagtattt
cccaagaagctagtgtctttctccacctggattgaccacacccgttgggctcgtaacacc
tgggcaatggcagctatattcatcctcaccatggctgacatcatggatatgctgagttgt
ctgcctgaagttccagattccggcagcaccacagtcgctccctcctcttcctcttcctcc
tccacctggtctggccttgaaggttgcctgaacaaccccaaatattacagctacattgct
gtgctggcactgatggccaccaatatgctggttcaggtcagtcacatggtcaagctcaca
ctgatgctgctcatcacagtggccactggtatcgttaacatctacagctggaaggacatc
tttgaccgctatgacatggcccgcttccaggattacaggtcatatctggtgccctccaag
ttcacaatgacaattatgatcttcattatgatgggcagcttctattatttctcaagacac
gtagagaaacttgcacgcacccttttcctctggaagattgaggtccatgagcagaaggag
aaagtgtatgagatgaggcgctggaacgaagcattggtgaccaacatgctgcctgaacat
gtggctcgacacttcctgggttccaagaaaagagacgaagagttgtacagccagtcttac
gatgagatcggagtcatgtttgcttcaatccccaacttctctgacttttacacagaagag
agcatcaataatggtggtattgaatgcttacggtttctcaacgagatcatctcagacttt
gacagtttattggatgagcctcagttccgctgcatcacaaaaatcaagaccattggcagc
acctacatggcagcatcaggtgtcaccgcagacgtcagcaatggctactcctgcatgaag
aaagaggagcagtctgacaaagagcgctggcagcacctggcagacctagcagactttgct
ctggccatgaaagtcacactcatgaacatcaactatcagtcattcaacaacttcatgtta
cgcatcggtctgaataagggaggggtgctagcaggagtgattggagcccgcaaaccccac
tatgatatttggggcaacactgtgaacgtggcaagtcgcatggagtccacaggggtgatg
ggaaacatccaggtggtggaggactgctacaacatcctaaaggagtacagcttccgcttt
gtgaggaggggacccatttttgtgaaagggaaaggggagctgctcacttattttctgaaa
ggaagagacaaacaaggttcatttatcaacagctcctctgtgactctgccacaccaggtg
gtagacagctaa

DBGET integrated database retrieval system