KEGG   Alkaliphilus oremlandii: Clos_0292Help
Entry
Clos_0292         CDS       T00607                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
aoe  Alkaliphilus oremlandii
Pathway
aoe00473  D-Alanine metabolism
aoe00550  Peptidoglycan biosynthesis
aoe01100  Metabolic pathways
aoe01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:aoe00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Clos_0292
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Clos_0292
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Clos_0292
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:aoe01011]
    Clos_0292
Enzymes [BR:aoe01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Clos_0292
Peptidoglycan biosynthesis and degradation proteins [BR:aoe01011]
 Precursor biosynthesis
  Amino acid ligase
   Clos_0292
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 GARS_A RimK ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: ABW17855
UniProt: A8ML38
LinkDB All DBs
Position
345812..346918
Genome map
AA seq 368 aa AA seqDB search
MSKINVMVVFGGRSGEHEVSLMSATSVLRAMNKEKYNITTVGITKKGIWKLYRGSIDKIQ
SGEWEGIADNWAKENNFSTNISVLPSEEGKGIINFGDGKTEKIDVVFPVLHGPFGEDGTI
QGLFEMMNIPYVGTGVLASSLAMDKAMSKKLFELEGIPQAKYHAFLVKEYKENEKEVLDT
IEEKFTYPVFVKPANMGSSVGITKVHNREKLEKAIELAAKYDRKIVVEEGINGREIECSV
LGNDEPIASLPAEIIPSAEFYDYNDKYFAGTSKFEIPANLPEDVIEGIRSLSVKVYKLLD
CSGLSRVDCFIERDSNRILLNEVNTMPGFTQISMYPKMWEATGIEYEELIDRLIELAIER
FNERSILG
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagataaatgttatggtagtcttcggtggaaggtcaggagagcacgaagtttcg
ttaatgtcagccacttctgtacttagagcgatgaacaaagaaaaatacaatattactact
gttggcatcaccaaaaagggtatttggaaactatatagaggatctatcgataaaattcag
agcggcgaatgggaaggtattgcggataactgggcgaaggaaaataacttcagtacgaat
atcagcgtgttaccgagtgaggaagggaaaggcatcatcaattttggagatggaaagaca
gaaaagatcgatgttgtatttcctgtactccatggaccttttggagaagatggaaccata
cagggcttatttgagatgatgaatattccttatgtaggaaccggtgtattagcttcctcc
ttagccatggacaaagccatgagtaaaaaattattcgagttggaaggaatacctcaagca
aaataccatgcattcttggtgaaggaatataaagaaaatgagaaagaagttttagataca
atagaagaaaaatttacttatccagtttttgtaaagcctgcaaatatgggttccagtgtg
ggtattaccaaggttcataatagagaaaaactagaaaaagccattgagctagctgcgaaa
tatgatcgaaaaattgtggtggaggaaggcatcaatggccgagagattgagtgctctgta
ttgggaaatgatgagcccatcgcatctttaccagcggagattataccttccgcagaattc
tacgattataacgataaatattttgcgggcactagtaaatttgaaattcctgcaaatctg
ccagaggacgtgatcgaaggcataagaagtctatcggtaaaagtatataagcttttagac
tgtagtgggttgtcacgagtggattgcttcattgaacgagatagcaaccgtatattatta
aatgaagtcaatacaatgcctggatttacccagatcagcatgtacccaaagatgtgggaa
gccacaggaattgagtacgaagaattaatcgatcgattaatagagcttgccatagaacgc
ttcaatgaaagaagtattctaggatag

DBGET integrated database retrieval system