KEGG   Alkaliphilus oremlandii: Clos_1434Help
Entry
Clos_1434         CDS       T00607                                 

Definition
(GenBank) serine/threonine protein kinase with PASTA sensor(s)
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
aoe  Alkaliphilus oremlandii
Brite
KEGG Orthology (KO) [BR:aoe00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aoe01001]
    Clos_1434
Enzymes [BR:aoe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Clos_1434
Protein kinases [BR:aoe01001]
 Serine/threonine kinases: Other
  Bacterial family
   Clos_1434
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA Kinase-like APH Kdo RIO1 ETRAMP Pkinase_fungal
Motif
Other DBs
NCBI-ProteinID: ABW18978
UniProt: A8MH91
LinkDB All DBs
Position
1542304..1544259
Genome map
AA seq 651 aa AA seqDB search
MIGKVLGKRYEIIEKIGGGGMAIVYKAKCALLNRFVAIKVLRPEFINDKDLLDKFRKESQ
AAASLSHPNIVNVYDVGEEDDIYYIVMEYVNGKTLKEVIKEKGKLNKDEILDFTRQIALA
LKHAHANHVVHRDIKPHNILITEDHRAKVTDFGIALAATSSTITNTGSIIGSVHYFSPEQ
ARGGYTDEKSDLYSLGIVMYEMATGRLPFEGDAPITIALKHIQENPELPSQYNPSISKDL
EIIIMKLLQKEQINRYANAAALIEDLYKVKNNFELGDMDNTLRMEDSPTQIIPMVTANEI
KELTENRRKDSNSPTNKNNREDGKKRKILIGSAIGAALLAALVFTFAFFYISDFLKTEDV
VVPNFVGMTMDEATKEAATIGLKLNVTRKPDDAPKDEVIKQTTSPNMKVRKGFEVKIVVS
EGSELAVVPDLEYKDEADVPSILKKNGLVAGDVKREPSDLPIGTVINQNPRAGFKAERGS
TVNYVVSEGPATAMVVMPDLRGKTLEEAKAEITKNKLQVGTTDPKYSDVYAAGLVISQNI
DPNVETPEGSVVNLVVSQGPENPGSNEGETEENNNGNTPVTKQITINLSTYSGIVNVEVY
EVTALSNVKIYGKEYNLDNLRPEEKIIKVPVTGLGSEQYTVYINGENKGNL
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atgattggtaaagttttaggaaaaaggtatgaaattattgaaaaaataggcggcggtggt
atggctatcgtatataaagcaaaatgtgccctactcaaccgatttgttgcaattaaggtc
ctaagaccggaatttataaatgataaggatttattagataaatttagaaaagaatcacaa
gctgctgctagtttatcccaccccaatatcgtcaatgtatacgatgttggagaagaagac
gacatctattatattgttatggaatatgtgaatggaaaaaccttaaaggaagtaatcaag
gaaaaaggaaaactaaataaagatgaaatattagattttacgagacagattgctttggct
ttaaagcatgcacacgccaatcatgtggttcacagagatattaaacctcataatatttta
atcacagaagatcatagagcaaaggttacagactttggaattgctttagcggcaacttca
tccactattacaaatacgggaagcattatcggatccgtccactatttctctcctgaacaa
gcaagaggtggatatacggatgaaaaatcagatctgtattctttaggtattgtgatgtat
gaaatggctacaggtaggctgccttttgaaggagatgcaccgattacaattgctttaaag
catattcaggaaaatccagagttaccttctcaatacaatccttcgatttccaaagattta
gaaatcatcatcatgaagctccttcaaaaagagcagatcaatcgatatgcaaacgctgct
gccttaatagaggatctatataaagtaaagaataactttgaattaggggatatggataat
accttaagaatggaagattcccctactcagattataccaatggtaaccgccaatgagatt
aaagagctgacggaaaatagaagaaaggattctaatagtcctacaaataaaaacaataga
gaagatggaaaaaagcgtaagatattgattggatctgccattggggctgcgctattggcc
gcattggtctttacatttgcctttttctatatctctgatttcttaaagacggaagacgtt
gtagtaccaaactttgttggcatgaccatggatgaagctacaaaggaagcggctaccatc
ggcttaaagctgaatgttacgagaaagccagatgatgcaccgaaggatgaggttattaag
cagacaacgtcaccaaacatgaaagtaagaaaaggatttgaagtaaagatcgtcgtcagc
gaaggcagtgaattggcagtggtgccagatctagaatataaggatgaagccgatgttcca
tcaattttaaagaagaatggattggtggcaggagacgtgaaaagagagcccagcgatttg
cctattggtacggtcataaaccagaatcctagagctggctttaaagcggaaagaggttcc
actgtaaactacgtagtaagtgaaggaccagcaacggccatggttgttatgccagattta
agaggaaagactttagaagaagcgaaagcagaaattacaaagaataagcttcaagttgga
accactgatccaaaatatagtgatgtttatgcagcgggattggttatatcacaaaatata
gaccccaatgtggagacaccggaaggctccgtagtcaacctggtggtaagccaaggtcct
gaaaatcctggttctaacgaaggagaaacagaagagaataacaatggaaatacacctgta
acgaagcagattaccattaacttaagtacctacagtggtatcgttaatgtagaagtttat
gaagtaactgccttaagtaatgtaaaaatctatggcaaggaatataatttagataatcta
cgccctgaagaaaaaatcattaaggtgccagtaactggcttaggtagcgaacaatatacc
gtgtatatcaatggagaaaataaagggaatctttag

DBGET integrated database retrieval system